ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10672

Name

GNA13

Synonym

G13;guanine nucleotide binding protein (G protein), alpha 13;GNA13;guanine nucleotide binding protein (G protein), alpha 13

Definition

G-protein subunit alpha-13|g alpha-13|guanine nucleotide-binding protein subunit alpha-13

Position

17q24.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vascular smooth muscle contraction;KEGG PATHWAY;hsa04270

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

S1P3 pathway;PID Curated;200035

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

pkc-catalyzed phosphorylation of inhibitory phosphoprotein of myosin phosphatase;PID BioCarta;100100

Pathway

S1P4 pathway;PID Curated;200043

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

S1P2 pathway;PID Curated;200181

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Sphingosine 1-phosphate (S1P) pathway;PID Curated;200104

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Disease

Neoplasm metastasis;FunDO

Disease

Prostate cancer;FunDO

External Links

Links to cell senescence gene database

10672

Links to epithelial mesenchymal transition gene database

10672

Links to ovarian cancer gene database

10672

Links to endometrial cancer gene database

10672

Links to iHOP

10672

Sequence Information

Nucleotide Sequence

>10672 : length: 6326
CTCCTTCCCTCCCTCCCTCCCCCGCTGTCCTGGCCCGCCCTGCCCGGCCCGCCCTGCGAG
TCAGTTCGCTGGTTCCCTCCCTCCCTGGGCGCGCTCGGGCCGCCGCCGCGCTCCCCGCCC
TCGAGCCTCGGTGCCGGAGCCGCCCGCCGCCGGAGGAGGAGGTGGAGGGAGCCGGAGGGG
CCCGCCGAGGCGGCGGCGGCGGCGGCAAGATGGCGGACTTCCTGCCGTCGCGGTCCGTGC
TGTCCGTGTGCTTCCCCGGCTGCCTGCTGACGAGTGGCGAGGCCGAGCAGCAACGCAAGT
CCAAGGAGATCGACAAATGCCTGTCTCGGGAAAAGACCTATGTGAAGCGGCTGGTGAAGA
TCCTGCTGCTGGGCGCGGGCGAGAGCGGCAAGTCCACCTTCCTGAAGCAGATGCGGATCA
TCCACGGGCAGGACTTCGACCAGCGCGCGCGCGAGGAGTTCCGCCCCACCATCTACAGCA
ACGTGATCAAAGGTATGAGGGTGCTGGTTGATGCTCGAGAGAAGCTTCATATTCCCTGGG
GAGACAACTCAAACCAACAACATGGAGATAAGATGATGTCGTTTGATACCCGGGCCCCCA
TGGCAGCCCAAGGAATGGTGGAAACAAGGGTTTTCTTACAATATCTTCCTGCTATAAGAG
CATTATGGGCAGACAGCGGCATACAGAATGCCTATGACCGGCGTCGAGAATTTCAACTGG
GTGAATCTGTAAAATATTTCCTGGATAACTTGGATAAACTTGGAGAACCAGATTATATTC
CATCACAACAAGATATTCTGCTTGCCAGAAGACCCACCAAAGGCATCCATGAATACGACT
TTGAAATAAAAAATGTTCCTTTCAAAATGGTTGATGTAGGTGGTCAGAGATCAGAAAGGA
AACGTTGGTTTGAATGTTTCGACAGTGTGACATCAATACTTTTCCTTGTTTCCTCAAGTG
AATTTGACCAGGTGCTTATGGAAGATCGACTGACCAATCGCCTTACAGAGTCTCTGAACA
TTTTTGAAACAATCGTCAATAACCGGGTTTTCAGCAATGTCTCCATAATTCTGTTCTTAA
ACAAGACAGACTTGCTTGAGGAGAAGGTGCAAATTGTGAGCATCAAAGACTATTTCCTAG
AATTTGAAGGGGATCCCCACTGCTTAAGAGACGTCCAAAAATTCCTGGTGGAATGTTTCC
GGAACAAACGCCGGGACCAGCAACAGAAGCCCTTATACCACCACTTCACCACTGCTATCA
ACACGGAGAACATCCGCCTTGTTTTCCGTGACGTGAAGGATACTATTCTGCATGACAACC
TCAAGCAGCTTATGCTACAGTGATGTACAAAAGACTTGCTGTTTTAATATCTTTTTGTGT
TTTTGATGTTTTCTGTTTGTTTTGTTTTTTAAAATAGCAGTTTACAACCAGAATTAGAAC
AATCTTAATTCTACGTTTAACTTCTTGAAAATCTTAGTACTTTTTCTGCGGCCTTTGGTT
TGTGGCTGAAAGCTGTTGAGTGACTCATCGCCAAGATTTGCTGTAATGCAGGCTTTGATC
TGTTTCACCATGGCTTCTATTCAAGTCCAGTTAAAACCTCCCAGCTGACCTCAGACTAGG
CATATTTCAGGCTTTAAATTATTCTACTTTCCAAACTGAATTCTCCTGCAGTGCCAAGTA
TCAAAGGTGTCCTTAAATACTTGTAGGGATGAGGTTAGGAATATTCAGTTCCAAAACAAG
ATATCTTCTGTCCGCCTTACATATAGCAGTGACACTTGTTGCCTAACTTTATGGTGACCT
CCTATTTTGTAAGGGCTGTTAGAAGTTCTATCTAAGAAATGGCATTCTGTAGGTTTATAG
AAGGTTTAGCCTTCATATTTTAATTGCTTGTATACACAACAGCTGTTTTGCTTTTAGATT
TCTGTGTTTCTGAAGGTAATGTTCTTCCTGTTTTCAAGTTTACATAAGGATCTTTGGTCT
GATGCTGATGAAGAGTTCACAGGTGGTATGGGAGAGCAAAAGGCAAGCTAATGCTGTTTA
CCGTGTTTTGGTCAAACGTAACGAGTGAAATAGAATTTGCCTTTCTCATATTTAATTATC
ATGTAGTTTAATGTACCATATGTGAAACATTCTGGCCATAGCAGCAACTAAAAACTGCAA
GCAACTTGGTAACAGAACTTTCTAAATAAACTTAACCTGTTCCAGAATGTCATGTATTTG
ACTTTTAAGCCCTATCTCAGTTGGTCAGTAAAGACCAATCCTTACTGTAGGAAATCATTG
TTGTATCATCACAAACATCTATCTTTTGCTGTCCTGTCCAGTCCCATCAACTCCACACTG
TGCCATTTGTGGCATCGTTTTGTTTATTTGGAGTTTGCTAAGGGCAGTATTTTTCTGTCA
AGACTATTCAAGAAGGCATTATTTGAGATTCCTGTTCATTCTTGGTGTGTCTCTAACAGA
TACAGTATGTATACATTTGTATAATTGTTGTTGTTGAAAGTCCAGCTTTTTTGAGGTATA
TTTTAAATGTTTTAAGGATGCTTCTAAGGATCAGTAGTAATTTTTTTAGTTCGCACCTAA
AGATGATTACATTGACCTCCCCCGACTGCTTACCAAATTAAAATGTGTCCACGAAGTAGC
TTTGTGATCGCAGATACATTCATAGTGAACTCATCAGAATGGCTGGTTTGCAGTACTGAA
ATACTATCTTCTAGGCTGTATGTAGTGCTACAATTAGAGAAACAGAAGTCCAAGGCTGGC
GACAGCTTGAAAAGTCTGACAGCTTTTCTACTTTTCCTGAAAATTTTAAGACTGTGATAT
CTGTCATTTTACTGTATAGCTGACTGTGTACTCAGGTATTTTATTGGTCCTTGAAAGATT
GGTCGTTATGGATCACCCAGCCTTTCCAAGTCAGTGGCTGTTGTTCTGTCTTGCTGTCTG
ATACGAGAGTGGGGCTTTTCAGTGAACTAACCAGGGATTGTTCTTGACATACCTGACTTT
TCTCACATTTGAACTTCCACTATCATTGTATCCATATAACTTCTAGCATTTTCATGCCAT
GGTAATCCATGAGCTACACATACGTAGCCCGGCACCGTGATGCAAGTTCATGGTATCGTG
CATGTTCGTGGTATCATGGTATCATTCATGCGTGTTTGAATAGTTCTACATCTAGTGCTT
CTTGCCAAAAAGAATACATTGTTTAAATTCACAAAATTAGCATAATTGCAGTGCTAATGA
ATATCGGAATATGTGCACAGTAACATTTGGACTATTCATTGGAGAGTTTACCCATACATT
TAGCAAATTGAATGGCCAAAACATTTGACTCCAGTGAGGGCTCAAGTTAGATCCCTATAG
AAAGAGGACACTTCATCTTACTTAAGTCATAGTTAAGATCTGTGATACGAACCATAGATA
TTGCCTGACAAAGCAGAAATCACCAAGTTTCCCCCTTTTGAATTACCACCAAGAAGTGTT
GAAACACCAAATAGATATCATGTTATTTTGGGCATTTGCAGTTTTCTTCCCTGCTGCATG
TAATGTCTCAGAATCAACATTCTTTTAAAATCTAGACTATATTTTGAGGCAATGAATTAC
TTATATTCAACTTAGGCTTGTTTTGACATTCAGTAGAACTTTAAGTTCAATCTAAAGGCT
TCAGTCCACATTTTTTTATACGTTGTATTTTAAAAACGTTTGAAAGGAGTCTTACACCTG
TATCATGAAAACTGAATCCTTTTGAAATACCACTATATGAAGAGAGAGATGAAATTTAGT
GAACAGAATTGAAAAGGTGCTCATAATTTCACTATGCAAACTTACCCCAGTCTCTAAAAA
AGTAATTTAGATTTAAAGTTCTTTGATGTATTTGATTTTCTAAATCTTTATGGTTATGAT
TTGGAATAAAATGTGCCTAATCCTGTGTTACATTCTGTTCTTAAATCTGAATGCCTTCTC
ATTTAATTCTGAGGAAATATCACACAAGTGTCTTCATTGACCTTGAAGAAATGTATATAC
AGTTGCCTTATAAAACAACATAAATTTAGACCATAACTTTTATAGAGAAAGGGTTTTGTC
AAATGTTTTCTGAAAATCTGAGTAATTCAAAGCATGCCTCTGCCCCTTTAATATTTTTAA
TAACCTGCATTGTTGCTGTCTGCCAAATATTAAATTGAAATCTTCATTTCAATTTTATTA
TCTGGAAAGGGCACTGGATTGCTCTGCAACCAAAGAAAGCAATATGGAATGAAAAAACTC
ATTCACTTTTGTCTTATTTTCTTTTAAGGTGTATTGGCATGTAATTTGCATAGAGAAGGT
CCTCTGGTTAGTCTCTCAAATTGAGGCTGTTTAGGGAAATCCTTATTCAGTTGGTGGCAG
TGGTTGGTTTAAAGTAGAAGGAAATAAGATCGCCTTAATACCAGAAATGATTAGAAGTGC
TGATTTAGATTCAACAAATACCATATGTCCTTATCATTTTTTGTAAGAAGAAATTGGTTA
AGTCCTAACTTTCAATGTGTACCCAAATACTTGTATTTATGCTTTTGATAAAATGTATTT
TCAGCATTAATACACATCCGATTATGCCTTATTTATATATGAAGAATAAAGTTACCATGT
TACACTGTTATGTCCTAAAATTCAAATCACTATTTGAGAAACCCTCAAATTGGTGCTTTC
ATTATATAATGATACATTTAGACAAAACCCCAAACTAAGCCATTTGAAACAAGATTCTCT
CCATTGCAGTTTGTAGCAATGTTATTTCTGTGTATGTCATGAGAAGGCTAAATATCAGTG
TTAATTTCTTGTTTGAATCCGTGAAATCATGCCTGTAAAGCCCAAACATTTGTAACAAAC
TCCCTAATAAATTTAGAGAAAGTCACTCTGTTACCATTTCATTTATTTTAGTTTTATTTG
AGAAATTAAGACCAGAAGTTTTGCTCATGTCTTTTTCACTTGGAAATCTGACTTAGTACC
TAGTTAATTTGTCTCTCTCCCATCATTTTAAGGCGTTCGCTTCTGTTAATCACAGATGAT
CTGTCCTTGTGTTGTGCTGCTTGACTAAAAGCACTGTTTTGTTTTGTTTTGTTTTGTTTT
TTAATGATAGGATACAGGGTGGCTTTTCAGTCTAGTAAACATGAGGAGGGGAGAGATTGT
GGGTGGGTGTGGGTGTGTCCGCATGTCCCAAATACAGCACATGCCCATTTTTTTATGGTA
CGAGGTTAGGGCTTATTAATAAATGTATACTAGATCTTGAAGTGTAAGTCTAAGTCTGAA
CATTTTAAACAAGTTGGACTTTATGGCTTTTTCAAGTTCCATCAAGTAGATACTAGTCTT
AGGCTGGTAGGTGATTAACAACATCATTTGGAGTACAGTGTTTGTACCACTAGCATTCTT
ATGTCTGTACTTGAACGTGTAGTTAGCATTTAAGTTATGTTCACTCTTGTAGCATTCAGG
TCTTACCATCTGGTTTCAAATGCGAGAGCTTATATGAACATTGTTTTGAAAGCATGAATG
ATATGGCAATATTTTATGTCTTGATAAGGAGAGTTTTGTGACATATACAAATCTGCTGTT
GATGATGAAAGTTTACAGGTGGATCAGAGTATGCTGGAACTCAGTGTGCATAAAATTTCA
GTCAGTGAATATCACTGAACGTCATATACTACTTGGTATGTGACTTTGGTTTGTGTTAAG
AAAGCTTGTATATAATATTTTTTGCCATAGTAAGTGAGAAATTGTCCTTAATCATGCCTG
TTTGATGGTACTAGGAAAGAAAGGGGTAGAGATTAATTCTTGCACAGTATAAGCAACAGT
GCAACAAACTATGCCATTTACCTTTTACCTCTTACTTGAAGGCAGAATCGCAAAACGTTT
GAAATGGCTTTTCTAAACTACTCTACTCTGGTGAGAGCTCATTTACCACAAGAAGCCTTA
TAAAAAAGTATATTTTGTAATAACCCCGTAGATACTGTACCTAACAAAACATGACTCGTA
TTAGCTCTATAAAATATTTGTGGCTTAGGATTTTTTTTTTACATATATCTTTTTATAACT
TTCCAGGAACTAAGCACATTATCTGATAATTGTTGTAAATTTTTTTGTCAGTGCTTTAGT
TCAGGATGGGCAATAAATTATTTCTAAAGGAGGTCTAAAAGTGGAAAGAATGGTTTGATT
TTATAAAATGAGTTGCTAGTTCATTACAGCTTTTTACTTTTGTACATATTTTGCAAAACA
TTTGCCTCTTGCTATTAATATTTGCTTTGTAAAAATTACTGACATTTAATAAACATTTGT
AAACAATTCAAAAAAAAAAAAAAAAA

Protein Sequence

>10672 : length: 377
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ