ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10642

Name

IGF2BP1

Synonym

CRD-BP|CRDBP|IMP-1|IMP1|VICKZ1|ZBP1;insulin-like growth factor 2 mRNA binding protein 1;IGF2BP1;insulin-like growth factor 2 mRNA binding protein 1

Definition

IGF-II mRNA-binding protein 1|IGF2 mRNA-binding protein 1|VICKZ family member 1|ZBP-1|coding region determinant-binding protein|insulin-like growth factor 2 mRNA-binding protein 1|zipcode-binding protein 1

Position

17q21.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs);PID Reactome;500140

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Diabetes pathways;Reactome;REACT:15380

Disease

Mental retardation;FunDO

Disease

Primary tooth development (time to first tooth eruption);NHGRI

Disease

primary tooth development;GAD

Disease

Cancer;FunDO

Disease

Primary tooth development (number of teeth);NHGRI

Disease

DEVELOPMENTAL;GAD

External Links

Links to cell senescence gene database

10642

Links to epithelial mesenchymal transition gene database

10642

Links to ovarian cancer gene database

10642

Links to endometrial cancer gene database

10642

Links to iHOP

10642

Sequence Information

Nucleotide Sequence

>10642 : length: 8769
ATTTAGAGGCGGCGCCAGGGCGGCCGCGGAGAAACGTGACACACCAGCCCTCTCGGAGGG
GTTTCGGACCGAAGGGAAGAAGCTGCGCCGTGTCGTCCGTCTCCCTGCGCGCCGCGGGCA
CTTCTCCTGGGCTCTCCCCGAACTCTCCCGCGACCTCTGCGCGCCCTCAGGCCGCCTTCC
CCGCCCTGGGCTCGGGACAACTTCTGGGGTGGGGTGCAAAGAAAGTTTGCGGCTCCTGCC
GCCGGCCTCTCCGCCTCTTGGCCTAGGAGGCTCGCCGCCCGCGCCCGCTCGTTCGGCCTT
GCCCGGGACCGCGTCCTGCCCCGAGACCGCCACCATGAACAAGCTTTACATCGGCAACCT
CAACGAGAGCGTGACCCCCGCGGACTTGGAGAAAGTGTTTGCGGAGCACAAGATCTCCTA
CAGCGGCCAGTTCTTGGTCAAATCCGGCTACGCCTTCGTGGACTGCCCGGACGAGCACTG
GGCGATGAAGGCCATCGAAACTTTCTCCGGGAAAGTAGAATTACAAGGAAAACGCTTAGA
GATTGAACATTCGGTGCCCAAAAAACAAAGGAGCCGGAAAATTCAAATCCGAAATATTCC
ACCCCAGCTCCGATGGGAAGTACTGGACAGCCTGCTGGCTCAGTATGGTACAGTAGAGAA
CTGTGAGCAAGTGAACACCGAGAGTGAGACGGCAGTGGTGAATGTCACCTATTCCAACCG
GGAGCAGACCAGGCAAGCCATCATGAAGCTGAATGGCCACCAGTTGGAGAACCATGCCCT
GAAGGTCTCCTACATCCCCGATGAGCAGATAGCACAGGGACCTGAGAATGGGCGCCGAGG
GGGCTTTGGCTCTCGGGGTCAGCCCCGCCAGGGCTCACCTGTGGCAGCGGGGGCCCCAGC
CAAGCAGCAGCAAGTGGACATCCCCCTTCGGCTCCTGGTGCCCACCCAGTATGTGGGTGC
CATTATTGGCAAGGAGGGGGCCACCATCCGCAACATCACAAAACAGACCCAGTCCAAGAT
AGACGTGCATAGGAAGGAGAACGCAGGTGCAGCTGAAAAAGCCATCAGTGTGCACTCCAC
CCCTGAGGGCTGCTCCTCCGCTTGTAAGATGATCTTGGAGATTATGCATAAAGAGGCTAA
GGACACCAAAACGGCTGACGAGGTTCCCCTGAAGATCCTGGCCCATAATAACTTTGTAGG
GCGTCTCATTGGCAAGGAAGGACGGAACCTGAAGAAGGTAGAGCAAGATACCGAGACAAA
AATCACCATCTCCTCGTTGCAAGACCTTACCCTTTACAACCCTGAGAGGACCATCACTGT
GAAGGGGGCCATCGAGAATTGTTGCAGGGCCGAGCAGGAAATAATGAAGAAAGTTCGGGA
GGCCTATGAGAATGATGTGGCTGCCATGAGCCTGCAGTCTCACCTGATCCCTGGCCTGAA
CCTGGCTGCTGTAGGTCTTTTCCCAGCTTCATCCAGCGCAGTCCCGCCGCCTCCCAGCAG
CGTTACTGGGGCTGCTCCCTATAGCTCCTTTATGCAGGCTCCCGAGCAGGAGATGGTGCA
GGTGTTTATCCCCGCCCAGGCAGTGGGCGCCATCATCGGCAAGAAGGGGCAGCACATCAA
ACAGCTCTCCCGGTTTGCCAGCGCCTCCATCAAGATTGCACCACCCGAAACACCTGACTC
CAAAGTTCGTATGGTTATCATCACTGGACCGCCAGAGGCCCAATTCAAGGCTCAGGGAAG
AATCTATGGCAAACTCAAGGAGGAGAACTTCTTTGGTCCCAAGGAGGAAGTGAAGCTGGA
GACCCACATACGTGTGCCAGCATCAGCAGCTGGCCGGGTCATTGGCAAAGGTGGAAAAAC
GGTGAACGAGTTGCAGAATTTGACGGCAGCTGAGGTGGTAGTACCAAGAGACCAGACCCC
TGATGAGAACGACCAGGTCATCGTGAAAATCATCGGACATTTCTATGCCAGTCAGATGGC
TCAACGGAAGATCCGAGACATCCTGGCCCAGGTTAAGCAGCAGCATCAGAAGGGACAGAG
TAACCAGGCCCAGGCACGGAGGAAGTGACCAGCCCCTCCCTGTCCCTTCGAGTCCAGGAC
AACAACGGGCAGAAATCGAGAGTGTGCTCTCCCCGGCAGGCCTGAGAATGAGTGGGAATC
CGGGACACCTGGGCCGGGCTGTAGATCAGGTTTGCCCACTTGATTGAGAAAGATGTTCCA
GTGAGGAACCCTGATCTCTCAGCCCCAAACACCCACCCAATTGGCCCAACACTGTCTGCC
CCTCGGGGTGTCAGAAATTCTAGCGCAAGGCACTTTTAAACGTGGATTGTTTAAAGAAGC
TCTCCAGGCCCCACCAAGAGGGTGGATCACACCTCAGTGGGAAGAAAAATAAAATTTCCT
TCAGGTTTTAAAAACATGCAGAGAGGTGTTTTAATCAGCCTTAAAGGATGGTTCATTTCT
TGACCTTAATGTTTTTCCAATCTTCTTCCCCCTACTTGGGTAATTGATTAAAATACCTCC
ATTTACGGCCTCTTTCTATATTTACACTAATTTTTTTATCTTTATTGCTACCAGAAAAAA
ATGCGAACGAATGCATTGCTTTGCTTACAGTATTGACTCAAGGGAAAAGAACTGTCAGTA
TCTGTAGATTAATTCCAATCACTCCCTAACCAATAGGTACAATACGGAATGAAGAAGAGG
GGAAAATGGGGAGAAAGATGGTTAAAATACATAATAATCCACGTTTAAAAGGAGCGCACT
TGTGGCTGATCTATGCCAGATCACCATCTTCAAATTGGCACAACTGAAATTTCCCCACTC
TGTTGGGGCTTCCCCACCACATTCATGTCCCTCTCCCGTGTAGGTTTCACATTATGTCCA
GGTGCACATAGGTGGTATTGAATGCTCAGCAGGGTAGGGGCTGACCACTGTCCCTGATTC
CCATCGTTCTCAGGCGGATTTTATATTTTTTTAAAGTCTATTTTAATGATTGGATATGAG
CACTGGGAAGGGGACGCTAACTCCCCTTGATAAAGTCTCGGTTCCATGGAGGACTTGAGT
GGCCCCAAAGGCTGCCACGGTGCCCTCACCCCAGCCCATGTGCTCCCATAAGGGCTGGTT
CCTAGAGGCAGGGGTTGTGGGGCACTCCCAGCCACGGCACTGTTACCTTGGTGGTGGGAC
TTGGAACCCAACCCTGAGCTCCCGATAAAGCTAAAGTCCATCATCTGGCAAATTCAGTAA
ATTGGAGAGTACTTGCTTCTGTTTGTATCTGAGAGGAATTTTTAACTGACGGCTTCTGTC
TCCATGAATCATTATCAGCATGATGAAAGGTGTGTCTAAAAAACAATTCAGAATACCAGC
AGCATTGTACAGCAAGGGGTAAATAAGCTTAATTTATTAATTTACCAGGCTTAATTAAGA
TCCCATGGAGTGTTTAGCCCTTGTGGGAGACAGAAGCCATCAGTTAAATGAGGTTAGGCC
TCTCCTCCTAATATACTGATTGACAATGCATATTAGCCAGGTAATGCACTTTAGCTACCC
TGGACAATGCTATCAAGTGTGCTGGGAAGGGAGGAAGGCCTCTCTACATATGGAAAAGCC
CATGCGTGGAGTTCCCCTCCTTTCAACATTGCAACAACAGTAACAACAAGACAACCGCAA
CATGTGGGCGTAGTCAGGCAATGCTGTGTGCGAAGTAAACTACCTCAAGGTATGAAGTTA
CCTCAGCAATTATTTTCCTTTTTGTTCCCCCCAACCCCATTAAAAAAATTTTTTTTTGAT
TTTTGTTTTTTTGCAGCTTGCTGATATTTTATATAAAAAAGAAAAGCAAAGCAAAAGAGA
AGCTGATAGTCTTGAATATTTTATTTTTTTAATGAAAAGAAAAAACAAGAAAGTTATGTT
TCATAATTTCTTACAACATGAGCCAGTAACCCTTTAGGAACTCTCTATGGAGAACAGGCC
TGGTGGGAAAGGCTTTGGGGGCTGCCCCCTTAGGAGGAGGCTAGTGCTAAGAGGGAAGGC
CCAGGTTTGAGAGAGCCCAGAGGGGCAGAGCCCAGAGCCTTGTTTGGCCCTGATCTCTGA
CTTCTAGAGCCCCAGCTGCTGGCGGCTGCTGGAATATCCTACCTGATAGGATTAAAAGGC
CTAGTGGAGCTGGGGGCTCTCAGTGGTTAAACAATGCCCAACAACCAACCAGCTGGCCCT
TGGTCTCCTCTCTTTCCTCCTTTGGTTAAAGAGCATCTCAGCCAGCTTTTCCCACCAGTG
GTGCTGTTGAGATATTTTAAAATATTGCCTCCGTTTTATCGAGGAGAGAAATAATAACTA
AAAAATATACCCTTTAAAAAAACCTATATTTCTCTGTCTAAAAATATGGGAGCTGAGATT
CCGTTCGTGGAAAAAAGACAAGGCCACCCTCTCGCCCTCAGAGAGGTCCACCTGGTTTGT
CATTGCAATGCTTTTCATTTTTTTTTTTTGTTATTGTTTCATTTCAGTTCCGTCTTGCTA
TTCTTCCTAATCTATATCCATAGATCTAAGGGGCAAACAGATACTAGTTAACTGCCCCCA
CCTCTGTCTCCCTGTCTTCTTTAGATCGGTCTGATTGATTTTAAAAGTGGACCCAAACTT
AGGGAATTCTTGATTTAGGGTGGCTGGTGGCAAGGAGGGGCAGGGGATATGGGGACGTGA
CTGGGACAGGTTCCTGCCTTATCATTTTCTCCCTAGGACATTCCCTTGTAGCCCCCAGAA
TTGTCTGGCCCAAATTGAATAGAAGCAGAAAAACATTTAGGGATAACATCAGGCCAGTAG
AATTAAGCCTCTCCACCTGTCCCAACCATAAAAAGGGTCTCCCAGCTTTCCATCTCTGGC
TCTATATGCTTTATCCCAAAACAAAGCAGATAACGTTCAGACGTCGGCCATTTAGTAATT
TAAAGCGAATTTCCAGCAGCAAGCATGCTTTGATATCTGGTTCAGACTATCATCAGGAAG
AAAAAAAAATCCCACAGTACCTGAAATGTGATTGTTGCAGTGTTCAGTTTCCTTGGGGGC
CTGCTCCCTTCACACCTTGAGCCCAAGTCCTTTTCCGTTGGCTGATTCAGCTCCCAGAAG
AGACGAGGAAGTGTGTGGCAAGGGACTGGAAAACTTCACTTGCTTGGATTAGGCAAGGCT
CCACTCATTGTTGATATTTGCCCAGCAGGAAAATCATGTAAGTTATACCACCAGAAAGCA
AAAGGAGCATGGTTTGGTGGTTAAGGTTTAGTGGGATGAAGGACCTGTCTTGGTGGGCCG
GGCCCTCTTGTGCCCCGTAGGCTAGGTCTTAGGGCAACTCCTTGCCCTCCTGCTCAGCAC
CTCCATTTCCCCATCCTTGGTGAGATAACAAGCTATCGCGAAAAGCACTTGGGAGATTTG
GATGATTTGAGAAGAGTGACTTAAAAAAAATGCTTCTGTGCTCTAAGATATATATGTGTG
TGTGTGTGCTACATATATATTTTTAAGAAAGGACCATCTCTTTAGGATATATTTTTAAAT
TCTTTGAAACACATAACCAAAATGGTTTGATTCACTGACTGACTTTGAAGCTGCATCTGC
CAGTTACACCCCAAATGGCTTTAATCCCCTCTCGGGTCTGGTTGCCTTTTGCAGTTTGGG
TTGTGGACTCAGCTCCTGTGAGGGGTCTGGTTAGGAGAGAGCCATTTTTAAGGACAGGGA
GTTTTATAGCCCTTTTCTACTTTCCTCCCCTCCTCCCAGTCCTTATCAATCTTTTTTCCT
TTTTCCTGACCCCCTCCTTCTGGAGGCAGTTGGGAGCTATCCTTGTTTATGCCTCACTAT
TGGCAGAAAAGACCCCATTTAAAACCCAGAGAACACTGGAGGGGGATGCTCTAGTTGGTT
CTGTGTCCATTTTCCTCTGTGCCAAAGACAGACAGACAGAGGCTGAGAGAGGCTGTTCCT
GAATCAAAGCAATAGCCAGCTTTCGACACATACCTGGCTGTCTGAGGAGGAAGGCCTCCT
GGAAACTGGGAGCTAAGGGCGAGGCCCTTCCCTTCAGAGGCTCCTGGGGGATTAGGGTGT
GGTGTTTGCCAAGCCAAGGGGTAGGGAGCCGAGAAATTGGTCTGTCGGCTCCTGGTTGCA
CTTTGGGGAAGGAGAGGAAGTTTGGGGCTCCAGGTAGCTCCCTGTTGTGGGACTGCTCTG
TCCCCTGCCCCTACTGCAGAGATAGCACTGCCGAGTTCCCTTCAGGCCTGGCAGACGGGC
AGTGAGGAGGGGCCTCAGTTAGCTCTCAAGGGTGCCTTCCCCTCCTCCCAACCCAGACAT
ACCCTCTGCCAAACTGGGAACCAGCAGTGCTAGTAACTACCTCACAGAGCCCCAGAGGGC
CTGCTTGAGCCTTCTTGCTCCACAGGAGAAGCTGGTGCCTCTAGGCAACCCCTTCCTCCC
ACCTCTCATCAGGGGTGGGGGTTCTCCTTTCTTTCCCCTGAAGTGTTTATGGGGAGATCC
TAGTGGCTTTGCCATTCAAACCACTCGACTGTTTGCCTGTTTCTTGAAAACCAGTAGAAG
GGAAACAGCACAGCCTGTCACAGTAATTGCAGGAAGATTGAAGAAAAATCCTCATCAATG
CCAGGGGACATAAAAGCCATTTCCCTTCCAAATACTCGACAATTTAGATGCAGAACATTT
CTCTGTATTCAGACTTAGAGTAACACCAGCTGAAAACTGCAGTTTCTTTCCTTTGGATAC
ATAAGGCTTCTCTATCGGGGTACGGGACAGGGAGGAGGCCTCATGTCTGAAGGGGGATTT
AGGGGCGAGAGCCCCAGCCCTGACCCTCGGTCCTGTGCACCGCTTTGGGGCACAGTCTGA
TGGCGCCTTTGCTGGCGCCTTAGTATGGTTGACTCCGGATGGACAAAAGAAAAAAAATTT
TTTTTCTTGAATGAAATAGCAGGAAGCTCCTCGGGAGCATGTGTTTTGATTAACCGCAGG
TGATGGATGCTACGAGTATAAATGGATTAACTACCTCAATCCTTACAGTAAGATTGGAAC
TAAGGGCAGGGACTCATGCATAAGGGTATGAATCCCAGCCAGGACAAGTGAGTTGAGGCT
TGTGCCACAAAAGGTTTGTCCTTGGGGAACAGGCAGGCCTGCCAGGATCCCCCCCATATC
GATTGGGCTGGGAGGGCTGGCCATGAGGTCCCCACTTTCTGCTTTCCTTGCCCATGTGTC
ACCCCTTTGGCCTCCAGCTTGTCCCTCTCTCACTTTCTATAGCTTTGTTGGACCAGATGG
TGAGGAAAGGAATGGCCTCTTCCCTTCTAGAGGGGGCTGGCTGGAGTGAGACCTGGGGCT
TGGCCTGGAACCCACCACACAGCCCCAAAGTCAGGAAGCCTGGGGAAACCAGAGCTGAGA
CCTCTTCAACAGGGTTTCTTTGAGATCCTACACCTCCATTGGGCCCTTTTTCAGTCTTCA
ATGGGGGCCCAGTTGGCTCTAGAAGGAGAAGAGGTGAAGCAGGATCCTTTGCCCTGGGGG
AGTCTGAGGGCGCGGTCCTTGGACTCATTCAGGCCGTCTTTGTAGTTGGGGGAGTTCCAC
TGGGCGATCCCAGCCCCTCCCCACCCACCCTCTAATGGACCTCCTCATAGAAGCCCCATT
TCACTTTTGTTTTATCTACCTCTTAGCAAAACAATAGATAAATTAGGTAGTGGCAGCTCC
ACTTGCTTAGGTTAGGGGGGGAAAAAGATTTCTTTTTCCAAAGGAAAAAAATATTACCTT
GAGAATACTTTCCAAAAAATAAAATTAAAAAAAAAAAAACCAAAAAAAAAAATTTTTTTT
TAAAAGGGAGACATTTTCCAGTGACCACTGGATTGTTTTAATTTCCCAAGCTTTTTTTTC
CCCCATAAATAAGTTTCACTCTTTGGCGATTTTCTTCACTTGTTTAAGATAACGTGCTAG
CTATTCCAACAGGTAACAGCTTTCACAGTCTGCCCCTGGCCTGTCTCACCCCATCCCCCA
CCCTATTCCTGCCAGTGAGTCCTTCCTGTGCTTCTCTCCCTTCTCCCCTCCCAGCCAGCT
GACTTCAGTCACCCCTGTCCCCCCTCCCCTGCCAATAAGCTCCCCCAGGAATAAAGGCTT
TGTTTTGGGGATGCTTAAATCTTGACTGGCACTTCCCGGCTGTGGGGGCTGGGGAGCCAC
TTGTAACATTTCTGTGCAGATTTTATGTTAGCCACTGCTATGTAAAAGCACGTTCAAAAT
GAATTTCAGCAGATTATGTGTTACCATAATGAATAAACGTCCTCTATCACCATTTGGAGT
CTCCCTTTTCTCCAGGATCTTGATCCTGGTCCCCAAAACCAGAGTGAATCAAAAGAGCTT
CCTCCCCTGAGGCAAAGTGGATTTGTAAGCAGTTCTGAAACATCACTTACTCAGAAGAGG
GAACGATGTATTTTGATGAGTGCAAATTGGGAAGAGCTGGAGGCCTACTGCTTGGGACAG
TTTTTTTTTTTTTTTTTTTTTTAAATATGAGTGCTAGCTTATTCTGTAATTGCGGCAACT
TTGAAAATTGTATTTTACTGGAAATCTGCCAGCCATCACCACCCGATTTTGATTGTATCC
TTCCTCCCATCCTTTAATCTGTTCATTGCTTTGGGGGAGGTGGGGCAGCTGGCTCACACG
TTGGAGTTTGTTCTTTGATGGATGAACGAACACTCCAGTTTTCTTTCCCGTGAAGGTTGT
TTCAGCCACAAACCACTTCATTTTGCTGTTTCAATTTCAAAATAAAAGGAAACTTATATT
GAAAGACAA

Protein Sequence

>10642 : length: 577
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK