ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10591

Name

DNPH1

Synonym

C6orf108|RCL|dJ330M21.3;2'-deoxynucleoside 5'-phosphate N-hydrolase 1;DNPH1;2'-deoxynucleoside 5'-phosphate N-hydrolase 1

Definition

c-Myc-responsive protein RCL|c-Myc-responsive protein Rcl|deoxyribonucleoside 5'-monophosphate N-glycosidase|putative c-Myc-responsive

Position

6p21.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10591

Links to epithelial mesenchymal transition gene database

10591

Links to ovarian cancer gene database

10591

Links to endometrial cancer gene database

10591

Links to iHOP

10591

Sequence Information

Nucleotide Sequence

>10591 : length: 813
GCGCGGGCGGCTGGGGAATGGCTGCTGCCATGGTGCCGGGGCGCAGCGAGAGCTGGGAGC
GCGGGGAGCCTGGCCGCCCGGCCCTGTACTTCTGCGGGAGCATTCGCGGCGGACGCGAGG
ACAGGACGCTGTACGAGCGGATCGTGTCTCGGCTGCGGCGATTCGGGACAGTGCTCACCG
AGCACGTGGCGGCCGCCGAGCTGGGCGCGCGCGGGGAAGAGGCTGCTGGGGGTGACAGGC
TCATCCATGAGCAGGACCTGGAGTGGCTGCAGCAGGCGGACGTGGTCGTGGCAGAAGTGA
CACAGCCATCCTTGGGTGTAGGCTATGAGCTGGGCCGGGCCGTGGCCTTTAACAAGCGGA
TCCTGTGCCTGTTCCGCCCGCAGTCTGGCCGCGGTGAGCACCCCAAGCCTCCCTCCTGGC
TTTCTATGGACCCAGCCCTCAGCTCCTTCCCTGGTGGGCTCTGAGCACCGCGCCTCTCCC
AAGGGGTAAGGGAGCTGTGAGGGTGTGGATGGGAGGCAGCTTCACCTTTCCCTGCCCTTT
CCAGTGCTTTCGGCCATGATCCGGGGAGCAGCAGATGGCTCTCGGTTCCAGGTGTGGGAC
TATGAGGAGGGAGAGGTGGAGGCCCTGCTGGATCGATACTTCGAGGCTGATCCTCCAGGG
CAGGTGGCTGCCTCCCCTGACCCAACCACTTGACTTAATCTCACTTTCTTAAATTCTTCT
ATTCTCAGACACTGCTCTAGTACCATTCCTTCCTCTTAGCCCCAGGAGCAAATTAAAAGG
TACAGTTAAAATCCTAAAAAAAAAAAAAAAAAA

Protein Sequence

>10591 : length: 174
MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA
ELGARGEEAAGGDRLIHEQDLEWLQQADVVVAEVTQPSLGVGYELGRAVAFNKRILCLFR
PQSGRVLSAMIRGAADGSRFQVWDYEEGEVEALLDRYFEADPPGQVAASPDPTT