ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10542

Name

LAMTOR5

Synonym

HBXIP|XIP;late endosomal/lysosomal adaptor, MAPK and MTOR activator 5;LAMTOR5;late endosomal/lysosomal adaptor, MAPK and MTOR activator 5

Definition

HBV X-interacting protein|HBx-interacting protein|hepatitis B virus x interacting protein|hepatitis B virus x-interacting protein (9.6kD)|late endosomal/lysosomal adaptor and MAPK and MTOR activator 5|ragulator complex protein LAMTOR5

Position

1p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

calcium signaling by hbx of hepatitis b virus;PID BioCarta;100150

External Links

Links to cell senescence gene database

10542

Links to epithelial mesenchymal transition gene database

10542

Links to ovarian cancer gene database

10542

Links to endometrial cancer gene database

10542

Links to iHOP

10542

Sequence Information

Nucleotide Sequence

>10542 : length: 855
GAGGCCCGGCTGCAGACCTCTCCCGAGAGGGGAATAATCCGTGCCGGCCGGTTCCGCCAT
GGAGCCAGGTGCAGGTCACCTCGACGGTCACCGCGCGGGGAGCCCAAGCCTTCGTCAGGC
TCTGTGCGACGGAAGCGCAGTGATGTTTTCCAGTAAAGAACGCGGACGTTGCACCGTGAT
CAATTTTGTCCCTTTGGAGGCGCCGTTACGGTCCACGCCCCGCTCGCGTCAAGTGACTGA
GGCCTGTGGTGGAGAAGGACGTGCCGTGCCGCTGGGTTCTGAGCCGGAGTGGTCGGTGGG
TGGGATGGAGGCGACCTTGGAGCAGCACTTGGAAGACACAATGAAGAATCCCTCCATTGT
TGGAGTCCTGTGCACAGATTCACAAGGACTTAATCTGGGTTGCCGCGGGACCCTGTCAGA
TGAGCATGCTGGAGTGATATCTGTTCTAGCCCAGCAAGCAGCTAAGCTAACCTCTGACCC
CACTGATATTCCTGTGGTGTGTCTAGAATCAGATAATGGGAACATTATGATCCAGAAACA
CGATGGCATCACGGTGGCAGTGCACAAAATGGCCTCTTGATGCTCATATCTGTTCTTCAG
CAGCCTGTCATAGGAACTGGATCCTACCTATGTTAATTACCTTATAGAACTACTAAAGTT
CCAGTAGTTAGGCCATTCATTTAATGTGCATTAGGCACTTTTCTGTTTATTTAAGAGTCA
ATTGCTTTCTAATGCTCTATGGACCGACTATCAAGATATTAGTAAGAAAGGATCATGTTT
TGAAGCAGCAGGTCCAGGTCACTTTGTATATAGAATTTTGCTGTATTCAATAAATCTGTT
TGGAGGAAAAAAAAA

Protein Sequence

>10542 : length: 173
MEPGAGHLDGHRAGSPSLRQALCDGSAVMFSSKERGRCTVINFVPLEAPLRSTPRSRQVT
EACGGEGRAVPLGSEPEWSVGGMEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLS
DEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS