ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10456

Name

HAX1

Synonym

HCLSBP1|HS1BP1|SCN3;HCLS1 associated protein X-1;HAX1;HCLS1 associated protein X-1

Definition

HAX-1|HCLS1 (and PKD2) associated protein|HCLS1-associated protein X-1|HS1 binding protein|HS1-associating protein X-1|HS1-binding protein 1|HSP1BP-1

Position

1q21.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10456

Links to epithelial mesenchymal transition gene database

10456

Links to ovarian cancer gene database

10456

Links to endometrial cancer gene database

10456

Links to iHOP

10456

Sequence Information

Nucleotide Sequence

>10456 : length: 1196
ACGTCCGGCTTACCGTCGTTTACGACAGTGTCAGGATCGCGGGCTTGCTTTCCGGTAGCG
TGGGCTGACGCCTCGCTCAATTTCTCACAGGGCTGCGCAGGTTTCCCCCGTCTGCGAATG
GACCACTGGAGGGGTTCAAAGGTTCGCGTCCCAGTACGGGAATGAGCCTCTTTGATCTCT
TCCGGGGCTTTTTCGGCTTTCCTGGACCTCGGAGCCACAGAGATCCCTTTTTTGGAGGGA
TGACTCGAGATGAAGATGATGATGAGGAAGAAGAAGAAGAAGGGGGCTCATGGGGCCGTG
GGAACCCAAGGTTCCATAGTCCTCAGCACCCCCCTGAGGAATTTGGCTTCGGCTTCAGCT
TCAGCCCAGGAGGAGGGATACGTTTCCACGATAACTTCGGCTTTGATGACCTAGTACGAG
ATTTCAATAGCATCTTCAGCGATATGGGGGCCTGGACCTTGCCTTCCCATCCTCCTGAAC
TTCCAGGTCCTGAGTCAGAGACACCTGGTGAGAGACTACGGGAGGGACAGACACTTCGGG
ACTCAATGCTTAAGTATCCAGATAGTCACCAGCCCAGGATCTTTGGGGGGGTCTTGGAGA
GTGATGCAAGAAGTGAATCCCCCCAACCAGCACCAGACTGGGGCTCCCAGAGGCCATTTC
ATAGGTTTGATGATGTATGGCCTATGGACCCCCATCCTAGAACCAGAGAGGACAATGATC
TTGATTCCCAGGTTTCCCAGGAGGGTCTTGGCCCGGTTCTACAGCCCCAGCCCAAATCCT
ATTTCAAGAGCATCTCTGTGACCAAGATCACTAAACCAGATGGGATAGTGGAGGAGCGCC
GGACTGTGGTGGACAGTGAGGGCCGGACAGAGACTACAGTAACCCGACACGAAGCAGATA
GCAGTCCTAGGGGTGATCCAGAATCACCAAGACCTCCAGCCCTGGATGATGCCTTTTCCA
TCCTGGACTTATTCCTGGGACGTTGGTTCCGGTCCCGGTAGCCTTGTTAACCCTCAGAGG
CCTTCAAGTCCTTTCCACCTCTCACCCATTGCCCACCATTAATAAGCTTAGCTTCTCTTG
CCACCTCAGGGGCTTGGATATGTGGAATAGTGAACTGGGGCCATGTCAGTTTGTCACTCA
CCCAAACTGACCAATAAAACCTTTATTTATGCTAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>10456 : length: 279
MSLFDLFRGFFGFPGPRSHRDPFFGGMTRDEDDDEEEEEEGGSWGRGNPRFHSPQHPPEE
FGFGFSFSPGGGIRFHDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLR
EGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWPMDPHPR
TREDNDLDSQVSQEGLGPVLQPQPKSYFKSISVTKITKPDGIVEERRTVVDSEGRTETTV
TRHEADSSPRGDPESPRPPALDDAFSILDLFLGRWFRSR