ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10451

Name

VAV3

Synonym

vav 3 guanine nucleotide exchange factor;VAV3;vav 3 guanine nucleotide exchange factor

Definition

VAV-3|guanine nucleotide exchange factor VAV3|vav 3 oncogene

Position

1p13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Fc gamma R-mediated phagocytosis;KEGG PATHWAY;hsa04666

Pathway

B cell receptor signaling pathway;KEGG PATHWAY;hsa04662

Pathway

Signaling by GPCR;Reactome;REACT:14797

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

Regulation of CDC42 activity;PID Curated;200059

Pathway

Signaling by Rho GTPases;Reactome;REACT:11044

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

T cell activation;PANTHER;P00053

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

EPHA2 forward signaling;PID Curated;200185

Pathway

B cell activation;PANTHER;P00010

Pathway

EPHA forward signaling;PID Curated;200121

Pathway

Fc epsilon RI signaling pathway;KEGG PATHWAY;hsa04664

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Natural killer cell mediated cytotoxicity;KEGG PATHWAY;hsa04650

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

10451

Links to epithelial mesenchymal transition gene database

10451

Links to ovarian cancer gene database

10451

Links to endometrial cancer gene database

10451

Links to iHOP

10451

Sequence Information

Nucleotide Sequence

>10451 : length: 10283
CAGCACTAATCCTCTATGACGCAGAGCCTCAGCTACTTAGCAACCAGAGCAGCGCCTTTT
AAGAAGGAACGGACTTTATATGATTTAATAAGTATGTATTTAAAGTTAGAGCACACACAG
TCATCTGTGATTCTTGGTGTCAGTGTTTCATCAGGGTCCCCTGCACTTCAGATTCTGCAT
TCCTTGCCTGTTTGCCTTCAACCTGCTGGTGGGCAGTCCCTAAGAAAGAACAGGCATGGA
AGTGGGGAGAGCCATACGTATTTAAAATTTCTCTGTTTGAAGAACATAAGGACATTTCTC
ACGGCCTGTTGTGAGACGTTTGGAATGAGGAAAAGTGAACTTTTCGAGGCATTTGACTTG
TTTGATGTTCGTGACTTTGGAAAGGTTATAGAAACATTATCACGACTTTCTCGAACACCT
ATAGCATTGGCCACAGGAATCAGGCCCTTCCCAACAGAAGAAAGCATTAATGATGAAGAC
ATCTACAAAGGCCTTCCTGATTTAATAGATGAAACCCTTGTGGAAGATGAAGAAGATCTC
TATGACTGTGTTTATGGGGAAGATGAAGGTGGAGAAGTCTATGAGGACTTAATGAAGGCA
GAGGAAGCACATCAGCCCAAATGTCCAGAAAATGATATACGAAGTTGTTGTCTAGCAGAA
ATTAAGCAGACAGAAGAAAAATATACAGAAACTTTGGAGTCAATAGAAAAGTATTTCATG
GCACCACTAAAAAGATTTCTGACAGCAGCAGAATTTGATTCAGTATTCATCAACATTCCT
GAACTTGTAAAACTTCATCGGAACCTAATGCAAGAGATTCATGATTCCATTGTAAATAAA
AATGACCAGAACTTGTACCAAGTTTTTATTAACTACAAGGAAAGATTGGTTATTTACGGG
CAGTACTGCAGTGGAGTGGAGTCAGCCATCTCTAGTTTAGACTACATTTCTAAGACAAAA
GAAGATGTCAAACTGAAATTAGAGGAATGTTCCAAAAGAGCAAATAATGGGAAATTTACT
CTTCGAGACTTGCTTGTGGTTCCTATGCAACGTGTTTTAAAGTACCACCTTCTCCTCCAG
GAACTGGTCAAACATACCACTGATCCGACTGAGAAGGCAAATCTGAAACTGGCTCTTGAT
GCCATGAAGGACTTGGCACAATATGTGAATGAAGTGAAAAGAGATAATGAGACCCTTCGT
GAAATTAAACAGTTTCAGCTATCTATAGAGAATTTGAACCAACCAGTTTTGCTTTTTGGA
CGACCTCAGGGAGATGGTGAAATTCGAATAACCACTCTAGACAAGCATACCAAACAAGAA
AGGCATATCTTCTTATTTGATTTGGCAGTGATCGTATGTAAGAGAAAAGGTGATAACTAT
GAAATGAAGGAAATAATAGATCTTCAGCAGTACAAGATAGCCAATAATCCTACAACCGAT
AAAGAAAACAAAAAGTGGTCTTATGGCTTCTACCTCATCCATACCCAAGGACAAAATGGG
TTAGAATTTTATTGCAAAACAAAAGATTTAAAGAAGAAATGGCTAGAACAGTTTGAAATG
GCTTTGTCTAACATAAGACCAGACTATGCAGACTCCAATTTCCACGACTTCAAGATGCAT
ACCTTCACTCGAGTCACATCCTGCAAAGTCTGCCAGATGCTCCTGAGGGGAACATTTTAT
CAAGGCTATTTATGTTTTAAGTGTGGAGCGAGAGCACACAAAGAATGTTTGGGAAGAGTA
GACAATTGTGGCAGAGTTAATTCTGGTGAACAAGGGACACTCAAACTACCAGAGAAACGG
ACCAATGGACTGCGAAGAACTCCTAAACAGGTGGATCCAGGTTTACCAAAGATGCAGGTC
ATTAGGAACTATTCTGGAACACCACCCCCAGCTCTGCATGAAGGACCCCCTTTACAGCTC
CAGGCCGGGGATACCGTTGAACTTCTGAAAGGAGATGCACACAGTCTGTTTTGGCAGGGC
AGAAATTTAGCATCTGGAGAGGTTGGATTTTTTCCAAGTGATGCAGTCAAGCCTTGCCCA
TGTGTGCCCAAACCAGTAGATTATTCTTGCCAACCCTGGTATGCTGGAGCAATGGAAAGA
TTGCAAGCAGAGACCGAACTTATTAATAGGGTAAATAGTACTTACCTTGTGAGGCACAGG
ACCAAAGAGTCAGGAGAATATGCAATTAGCATTAAGTACAATAATGAAGCAAAGCACATC
AAGATTTTAACAAGAGATGGCTTTTTTCACATTGCAGAAAATAGAAAATTTAAAAGTTTA
ATGGAACTTGTGGAGTACTACAAGCATCATTCTCTCAAGGAAGGGTTCAGAACCTTAGAT
ACAACTCTGCAGTTTCCATACAAGGAGCCAGAACATTCAGCTGGACAGAGGGGTAATAGA
GCAGGCAACAGCTAATGAGCTGTGTGCTACAACTAATCACAAAAGATTAGCATGCAAACA
AAAGCATGTTATGGTTGGACTGTGAGTCTAAGTCGAAAACCTTTTCTCTCATCGTTTAAT
GTTACATAATCTTCCTGGAGATAGAGCATGTAACAAAAAAATTGAAAAATGTCATCAAGA
AGGTGTGATTTTATTTTCTTAATCTGATATCACTTTATTTTTTTTAAATAAGTGTTTTGG
GGAAGAAGTGAATACAATTTCATTACTCTTAGAATCTTTAGCCTAAGCAACACTGGGATA
TCTAGAGGTATTTGAAAACAGAATTTGCGTCGGTTTAATATAACTTTATATTTTTCCTTG
AAAGCAGAAACTGAAAGGGGAACAGGTAATGCTCTGGGTTTCAACAACATCAGTGAAGTT
TTATACATTTCAATTCAAGTAAACAAACAATCTGTCACATCAACTGACATATTTTTTATT
TAAGTAACTTAATATATGTTTTCCTCACAGTGATCAATGATGTATGCCTAAGCTCGTGCA
ATGAAAGTAGAGCGAACTTTATGTTAAAACTTTAAACACCTATTAGATTTTATGGTGTTA
TTTTTTAGCCCAAGATTACCTGATTATTTTAGATTCTCAAATAGGCATAATTTTTGCTCA
TTCAAAAATGGAAGTTTTCTCCAAAAAAACAATTTTCCTACCAATATCTTAAAACTCTGT
TGAAGCTATGACATTTCCCCCAGCATGAAACATGTAATTTTCGAAGCTCTGTTTCTTTGC
CTTCCCAGCAGCAAGAGATAATAAAAGTTGCCAGGGAGGTCAGTTAGATGAAAAATCCTG
TTTGAGTTGTTCACTTAGCTCTAGAGAGCCTAGGAGGGAGAAGTGGGGCAGACAGGGAGA
ACAGATGTCCCATATTAGGTAGGAAGGTCACTAACCCTCATATTTCACTCTGTGGTTCAC
TCCCAGCCAATTCCTTAGTGTTTAGTACATGGAGGTACTCAGAGAATGTAGCCCGGCAAT
GAATGAAGTTGTCTAACTTAAAATTATGTCTCATGTTTAATGAAGTATTTAATGCTCAAC
TTGTTTGACAACTAAGAAGGGAATTACAGGACTTTTTCTTAAAAAAAAGCATAGCCAGTA
GAATGTCTTTGAATATCCATGCTAGCCCCAGATAAATTTTTCAGCAAATAAACTCATGAG
TTCAAACTTCCCTATCCAGTCTTTTTAAGAGATTCTGACAACTTGAATCAAGCCACTAAA
ACTTTTTTTTTGTAATTGTGAAGGGAAAGCAAACAATTCATTGAAAATTTTATATTTGTT
ATCGTTTGGTTTTGTTCATCAATTATTCATTCATTCGTTAAACAGATATATATTAAACAC
CTAACACATACAAGGCACTGTTCTGGTTCTGGGATATAGCAATTAAGAAGACAAAGTTCC
TGCCTTTATGGAGTTTACATTTCAATGGGGAAACTCAGGCAAGTCTGGTTTGGAGGAGTT
TCATATTTTTATATAGAGTGGTCAGGTAAGATCTCCCTCGTAAAGCAACTCAAAAGGAGA
GAAGGGGTGTAGGTTGGTAATGATTGCACAGTGGTTAACACTCCAAGATTAGTCATTCGT
TACTGCAAAGAAGGATTACAATCTTAGATCAAATTTGTGATACCATTCCAGTGTTTTATT
TACTTTATACTAACTTTGTATAAAGTTAGAGGAAGACTAAGATGGTTCTGAGGACTAAAT
GAGGTGTTCTATATAAAGCACTTAGCATAGTGCTCTTACATGGTAAACAGTAAAAGTTAC
TGCTGACTCTACAACTTCTACTTCCTCTACTACTGCTGCTACTTCTAACTCTTATTCTAA
CACAGTACTTTCCTATATTTCTAAGGCTTGAATACATTTACTAATTATGACTCATAGCAA
TGTACATCTTTGCCTTTATGATTTTTTAAATATAACTTGCTTATTTTTATACCAAGTCTT
GATAAAAGCTCACCCTTAAAGAAAGACTGCTTCTATTTTTATGCATTTTATACATCCCAG
GAAGTGGTAAGGAGGAAATGCTGCATGTTTGTATAGAAAGATTGTGCAAGATGTCTTCAT
ATTGCTTACCTTTGGTTCATAGCTTTAGGTATGCTGCTATCATCTAAAAATAACATTTGC
CAAGCATTATTACCTTGGGATACTGGGTTGGACAGAAATGGCATCTCCATTACTTCTAAA
AGTCCTTGGAGGATACAGAGCAGGCAAGGTAAAGCTTGGAACCATTCTGTGTTCTGAGTA
GAGGTTGAGAATAGAACTTCAACTCCTGAAACCTGCTGTTTATTATTGTTATTATTTTTA
AATAATCTAGTCACCTTGGAAAAGAAAGCCCCAGGGCACTGTAGTGGCCACTTACTTTTG
GGCTACTCTAGGTTAGAATGTTCGTAGAATGTTTACCAATTATTTTTTCAAGTATGTACA
ATGTGATAAGATTATGACAGGACTATCTTATGCAAATTCAAAGTAACATCTAAAAAGATA
TTGATTAGAATTAAGCAAGTGTCCAAAGTATTGGGCAAGGAGCATAACATTTTAAAGTTA
GGGGCCCATTGTAGGCTGTCTCTCAGCCTCTCTCCCAGAGTGATGGGATTTTATCTTTGT
CTTTGGAATGACTTAAGAGCATTTCTAAGGGAGAAGAAAAGAGAGAAAGAAAAAGAACAA
AGAGAGAACTCAGGCATAGCAGGGAGCTCTTGGGCTTCCTCTAGAAACTTCAGTGACTCC
ATGAAAGATGTTCTATGGATCTTTGTAAAAATCCCATTATTTTCCAAAATGGTCATCTCA
AACCTGCCTTAGATTGCTTTAGGTTTACCTGTAGGGCTTGTATATTTGAAGGGCATTAAA
TTGACTTTTGCATTTCTTGCTCTACAATGAACACATAATTATTTTGAGGTCTGCCAGAGT
AGCTGTCTGACCTTAGGCGAGTCACTTAGCCTGTCTGGACCTTAGCTTTCTCATCTGATG
AATGAGGAATGAAATTAGAGATTTTATAATGTTCTTTTAAAAATAGCATCTTAGGTTTTT
TCCTTTGTTTGCATGAGAGAAGCAGGTAAGGTAATGTTAACAGATTGGTGCATTAGGAAA
AGTTGTATGTTTAGCTATTTTGTGACCCATAAGCAGACCTTAAATATTTTGCCAAGTTTT
TATTTGTAGAGAATTAGTTGGGCCACAGAGTAGAGTTGGGTAATTTTTTTAAATGGCTAT
CACTATATTTATATAATATCCAAGTATCTTCTGTAAGAACTTATTAATTACAAAAGGGTA
ATAGTAATAACCAAGTGATTGAAGTTAACATCCCTAATAATGGGACAAATAAATATCATG
TACCTCCTAATATAATGCTCCAAGCAGGACAAACCAACACTTTGGTGGTATTATTGTCCC
CAAAAAGCATAAGTGGAATCTAATCATGAGGAAACATCAGACAATCCCAAACTAAAAGAC
ATTCTGCAAAATAATTGGTCTATACTCTAAAACCTTCAGTGTCATTAAAGAAAAAGTCTG
AGGAACTGTTTCAGATTAAAGGAGACCAAGAGATGTGACAACTACATATAACATGTGGTC
TTGGATTGAATCCTAGAACAGGGGTTGGGAAGATACATACACACACACACACACACACAC
GTATGTATATATATGTGTGTGTGTATAGTAACATATTTTGTATATGTTATAAAATATGTG
TGTATATATGTTGCTATAAAAGATGTGATACAATTGGCAAATTTTGAATAAATTCTCTTG
ATTAAAAAATAGTACCGCATCAATGCAATTTTCTGCTTTTGATAATTGTACTGTGGTTAT
ATAAGAGAAGAGAATACCTTTGTTTTTCAGGAACGTGTGCTGAGTATTTAGCAATAAGGG
GCATTATGTCTGCAATTTATTCTCAAGTGGCTCAGGAAAAATACATAGATTGATAAAGCA
AACATCATAAAATGTTAACATTTGGGGAGTCTGAATGAAAAATATGTGGGAATTCCTTTT
GCTCTCCTTGCTACTTTAAGTCTGAAATATTTCAGAATAGAAGTTTTCAGTTGTGGAGAT
GATCCCATTTGCTGGCTATATCTGAAGAATTGGGAGGTAGTGACAGTGTCCTTCTTTTGC
CTGCTTCAGACATAGAAGCGTCTGGTCCATTGATTTCAGGACGTGTGGAACACTAGCATG
TACTGAACAGATCATATTTGAAGCCATCCGTTCCTTACCTGTGACCTCATTGGATTTGCT
TCATTCATTCATTCATTCATTTATTCATTCATTCATTCATTCATCCCTTTATCCTGAAAA
TATTTTCAGTACTTAGTATGTGCTAGGCCTTGTGCTAGATACTTGAATTATAATAGTGAA
TAAGATACACAATCTGGTGAACAAGAACAGACAAAAACAAACACCTTCAATAATCACAAA
TTTTGATAATCCTTATGAAGCTGAAGCATAAGTGCAAGGAAATGGGAGCAGGGCCATTTA
GCCTTCAGGGTCAGAGAAGGGCTTTTTGAAGAAGTGACAGTCAGGCTAAACTTAAAGGAT
CTACAAGAGCTGACAGGGTGTGGGGTGGTGGCCAATAGGGAACCTGCATAGCAAAGAGGT
CGTTTGTGTGAAGGTTCATAAGCATTAGAGAACTTCATATTTTTAAGGAACTGAAAAAGG
ACCAATGTGTTGTGAGTATAGTAAGTGGATTCTGATATTTGCACTAGGAAAGTATTGAAG
TTTTACAGACAGAAAATGGCATGAACTAATTTACATTGTCTTAAAAGACCACTGACTGTT
CCTGAGGAGTGGCCTAGAGGGAGGCATGCACAGAGGGAAGATGAGTTAGGAGGCTATTGC
AGATGTCCGTGAGAGGGATAAGCATGCTTTGAACATGAGTTGCATAGTGACAGCAGAGAA
GGATAGTGGCAGGTTTGCGTATATCTTAGAGGTTGAGTTGATTGGATAAAGGATTTGAAA
TCAAATTAGTACAAGTATGGTACATAAGTATTTGCTTTGGACAACTGGCAAGTGATAAAA
CCATTAACAATCCAGGAAACAGAAGAGATAGAACAGATTTAAGAGAAAAGAGAATATATT
CAGTTTTGCACAGTGTTTAGGTACCTGCGGATATTCAATGGTTCAGGATGCAGCTGGCAC
TGAGGAGAGTGGTCTGGATTGAAGGTAGAATTTTATGAATCATTAATACTCCATTTCATA
GTTCACATAGAATATAGTGATGTGAGAATTATAGGCATTTGTATATAGGCTTAATTTCTT
CTGGTGCATTGTTTGCTGGAGCCCTAGAAGCCAGGACCCTTTGCTTGTCATTCTCAATTG
TACTTTTGCACATGCCTTGCATGAAATAGCCTCAGAAGGGGCTAAATAAGAGAAGTCAGA
GTCTAAGGTTCACAGGAGACACAGCAGATATTAGAGTGCTAAGTTGAAACTGGAAAAGCA
TGGGAATATGGGTGAGTTTGAAAACAAAGTGTAGATCAGCATGTTCCTTTCAGTGTGGTG
ACAAATAGTGTAGCAATTCTTCAAAGATTGACAAAGGCTACTTTTGTCATTGGAGCCATA
AGTTTGACCTTGCAGGAAGAAGTAGAAGCCAGAACAGAGCCTAGGCTGTCTCTCCCTGGG
TGTGGTCTCTTTCCTGTCACCCACTGTCCCCATTATTCTATTCACCATCCAACAACATGC
TTATCCTTCATTTTTAGTCAGTATTTTGGGTAGAAACAGAAACTTGGATAATTTGTGTCG
TATTTATTTAACTCAGTAGAACATAAAGTAGCATTCTTATTCCTGATAATTCCTTAAACA
TCCTAATAATTCCTTAACTACTATTTATTAGTTATATTACAATAGAATAGAGACAATATT
TATTATCTCCTTCGTACAGGTTCCTAACCATCCACTTAACTTAGTTTCTCCCTTGCCCTT
TTAATTCAGCATTCCCATATTCACCTGCCTTTATTTTCTGATTTTATTGTATCCTCAGTT
TTTTTGTCATCTTTTCCTCGGTCATTTTGCAATTGGGTTTGATATGATCTAATTTTATTC
TGGTAATTTAAATATTTGTTTTAATCTCATTATATTGGTTTCCTAGTACTGCTATAAAAT
TATCACGAACCAAGTGGCTTAAAACAACAGAAGTTTACTCTCTCACCCTTCTGGAGGCCA
GAAGTTGAAAACCAAAGTGTTAGCAGGGCTAATTCTTCCTGGAGGCTCTGAGGGAGAATC
CCTCCCATGCCCCTCTCCCAGTTTCTACTGGCAATCCTTGGCATGGCTTGGTTTATAGAT
GCACCGCTCCAGTCTCTGCTGGTCTTCACGTCACCTTCTGTGTGTATCATTGTCCCTTCT
TTTCTCTTATGGACACCTGTCATTGGATTTAGGGCCCACCCAAATACAGCTTGATCTCAT
TATGAGATCCTTAACTGAATTACATCTGCAAAGACCCCTGTTTCAAATAAAGTCACATTC
ACAGGTTCACAGGTCCTGGGTGGGCATATCTTTTTGAAGGGCCACCATTCGACCCACTGC
AGTTCCACTGTATTAATTTTAAACTTTTCTCTAAAATTTTCCATCCTTATTCTAATTTTT
CTTTTTGTCATTTTGTAACTTGGAGTTATAAGAGGACTTTACATTATTACAGCAGTCAGG
CAGTCAGTGAATGAGATTTATACAAGAAAAACACTACTTTAATACAAAAAAAAAGTGTTT
TCAATGAATTGTATTGCCTTTCCATGGTGAAATGCCTTATCTTTCTGAGAGACTGCACTT
CTAGCCAATGCAGGCTCCTAAACAATACTTGAATGACCATTTGTCTGAAACATTGTATTA
AATATTTTATATGGAATAAGAGAACCTAAGAATTCTGAAATTCAATAATTTGATGATTAA
CAGGACACTCTTACTTTTCAAACCCCTTTTACAAATATCAGATCAATATCTCCAATGGAG
TATTCCAGGAATCTCTAGCCCTGTGAGAAGTACCATGAAAAGATTTCTTTTGTCAAACAG
ATATATAAGAAATGCTGCTAGTATGATGTATTCCCTTCTAGGAAAGTGACAGTTTATCTA
GAGTTTTCCCCAGTTTATTTCATCATGCAACACTGTCTCATAGTGTTTAATGCTCATGTT
AGGAGGCTTAAAAGAGTTAGTAGGTGTGAAATACTGAGAATAGCATCTCACATGTGGGAA
GTGCTATGTGTTTTGCTCCTGCTATTACTACTGCTGCTCCTGCTACCACTTCCAATACTG
GTACCCAGTGTGAAGTGTTACATTAGCCTCATTTGACAATTTTAAGTATATTTATAAAGT
CCTTCTCCTTTTCCCTGATACTTTGGTTTCCTACTTCTATTTCCTGGATACACACTATTC
CGGTATACACACTATTCTATGGACTAAGTTAGTTATAACATATTGCTGACATTTTTATAT
TCTTCTCTCTTCATTTATGATGTCCACATAATTTACAGTTCTTGAACAACTGATCAACTG
CAATTGCACATCTTCATTAGTAAGTGATGCTGGGCTTCCCTTTTTTATTTAGTTACTTCA
GGATCTTTACCAGCTACTCTAAAGCATTTTTATTCTGAGCCTGATGGCTTTAAAAGTTAG
CAACCAGTATCCAGGATCCCTTCAGAATATGGCTTGCAGGTGTAAATTCTACAGATTCAG
ATAACCTCATTCAGTGCTATCTTTTAAATGTTTCAAGGCTCAGAGCAGTACTTATGATCT
TAGAATTTCTCATCTTTTATACTGTTCATTAATACTTTTATAGTGTCTCATATAACCTCA
TGTTCTAAATTGAAAACTGGTCTCGGCCAGGCAGAGTGGCTCATGCCTGTAATCCCCAGC
ACTTTGAGAGGCTGAAGCAGGTG

Protein Sequence

>10451 : length: 863
MTQSLSYLATRAAPFKKERTLYDLISMYLKLEHTQSSVILGVSVSSGSPALQILHSLPVC
LQPAGGQSLRKNRHGSGESHTYLKFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRD
FGKVIETLSRLSRTPIALATGIRPFPTEESINDEDIYKGLPDLIDETLVEDEEDLYDCVY
GEDEGGEVYEDLMKAEEAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKR
FLTAAEFDSVFINIPELVKLHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSG
VESAISSLDYISKTKEDVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKH
TTDPTEKANLKLALDAMKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGD
GEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKK
WSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRV
TSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLR
RTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKGDAHSLFWQGRNLAS
GEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESG
EYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQF
PYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSAN
GWWRGEVNGRVGWFPSTYVEEDE