ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1045

Name

CDX2

Synonym

CDX-3|CDX2/AS|CDX3;caudal type homeobox 2;CDX2;caudal type homeobox 2

Definition

caudal type homeo box transcription factor 2|caudal type homeobox transcription factor 2|caudal-type homeobox protein 2|homeobox protein CDX-2

Position

13q12.3

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1045

Links to epithelial mesenchymal transition gene database

1045

Links to ovarian cancer gene database

1045

Links to endometrial cancer gene database

1045

Links to iHOP

1045

Sequence Information

Nucleotide Sequence

>1045 : length: 4648
AAGAGGGTGGTGACTTTCGCAGTCAATAATGAATTCTGACAAGTCCCTCTCATCCCTCCC
CTCCATAGCCCCGCTCCTAGGTTCCCAGGGGGTGTGGGGCGCCTCCAAGGCCCTTGGGGC
ATGGGTCGAAGAGCGCTCAGGGTCTGGTCATCGCGTTGCCCGGCACGTCCGGGACACTGA
AGGGGCAGCACCCGAGCAAGGGTCGCTCCGAGACACTTCCAGGCGAGTCTCCCTCCCGGG
GTGTTCGGCTGAGGGAACTGCCCTGCGCCTCAGCTCCGGAGGTGTCCTCTGTGGCTCCAG
CCAGGCTCCGGTGCCAACCCCGCCTGATACTATCTGCGTGACCCGGTCTGATTCTCCATT
TCCTCATCTGTAAAAAGGGGCGAGTACCAATGGCAGCCTGGAGTGGGTTTGAGGCGGTCA
CGCGTGTCCGAGCGTCCACCGCGGAGAAAGTCGCGTTAGTTCCCTTTACTTTCATAGCAG
GCGCGGGGTCGGGGCCGCAGCCCCATTCAAATGCGCCTGCAGGGTCGTGTTTATGTTAAT
GCGCCTGGCGGGGAGGGGGATGAAAGCCGGGGCCGCCATTTGCTCAGTAGTGGTAATTCA
AACAGAATGTGGTTGTTATTAAGGCATTGAAAGGGCTTTTCTTTGATAAGATCGCCTTGT
CCTGCATTGTTTGCGGCTGTGTTGGCCTTTCAGCGGCTCGGGGGAGCTCCCTCTGATCAG
GCCTGTATCTTCCCAGGACGCTTTTGTTGTGGTTTGCAAAGGGTTTTACCTGAACAAAGT
CAGCCTGCGGGGCATTAAACACCTCCAGGCAACTCCCAGGCCCTTCAGATCTTTCTGTGG
GATTGGGCACTGGGCGATTGAACCTGTTCAGCTGCAAGAAGACCCAAAAGTGGGACGGAG
CCAGAGAGAACAGCTTCTGGCCAGGGCTCTGCCAAGGGCTGAGCCAAGACAGACCTGGTG
GAGACGCCAGGCTCGGGCCTGCTCCAACATTGTGGACACTATTTGTCAAGGCCCTTCAGT
AAAACAATCAATCTGGGATTTAATATGTTGACTCAATCCAATGAGCATAGATCACTGGTC
AGGATAACTCTGGCCGGATTTGCAGCAGGAATAAATGGAGGATCAAAAAAGAAAAAGTAC
CAAACGCCAAACCTGGTCTGGGCAGCCCTCACTTCTCCTTCCTCCACAGTGAAAACCAGG
ACGAAAGACAAATATCGAGTGGTGTACACGGACCACCAGCGGCTGGAGCTGGAGAAGGAG
TTTCACTACAGTCGCTACATCACCATCCGGAGGAAAGCCGAGCTAGCCGCCACGCTGGGG
CTCTCTGAGAGGCAGGTTAAAATCTGGTTTCAGAACCGCAGAGCAAAGGAGAGGAAAATC
AACAAGAAGAAGTTGCAGCAGCAACAGCAGCAGCAGCCACCACAGCCGCCTCCGCCGCCA
CCACAGCCTCCCCAGCCTCAGCCAGGTCCTCTGAGAAGTGTCCCAGAGCCCTTGAGTCCG
GTGTCTTCCCTGCAAGCCTCAGTGCCTGGCTCTGTCCCTGGGGTTCTGGGGCCAACTGGG
GGGGTGCTAAACCCCACCGTCACCCAGTGACCCACCGGGTTCTGCAGCGGCAGAGCAATT
CCAGGCTGAGCCATGAGGAGCGTGGACTCTGCTAGACTCCTCAGGAGAGACCCCTCCCCT
CCCACCCACAGCCATAGACCTACAGACCTGGCTCTCAGAGGAAAAATGGGAGCCAGGAGT
AAGACAAGTGGGATTTGGGGCCTCAAGAAATATACTCTCCCAGATTTTTACTTTTTCCCA
TCTGGCTTTTTCTGCCACTGAGGAGACAGAAAGCCTCCGCTGGGCTTCATTCCGGACTGG
CAGAAGCATTGCCTGGACTGACCACACCAACCAGGCCTTCATCCTCCTCCCCAGCTCTTC
TCTTCCTAGATCTGCAGGCTGCACCTCTGGCTAGAGCCGAGGGGAGAGAGGGACTCAAGG
GAAAGGCAAGCTTGAGGCCAAGATGGCTGCTGCCTGCTCATGGCCCTCGGAGGTCCAGCT
GGGCCTCCTGCCTCCGGGCAGGCAAGGTTTACACTGCGGAAGCCAAAGGCAGCTAAGATA
GAAAGCTGGACTGACCAAAGACTGCAGAACCCCCAGGTGGCCTGCGTCTTTTTTCTCTTC
CCTTCCCAGACCAGGAAAGGCTTGGCTGGTGTATGCACAGGGTGTGGTATGAGGGGGTGG
TTATTGGACTCCAGGCCTGACCAGGGGGCCCGAACAGGGACTTGTTTAGAGAGCCTGTCA
CCAGAGCTTCTCTGGGCTGAATGTATGTCAGTGCTATAAATGCCAGAGCCAACCTGGACT
TCCTGTCATTTTCACAATCTTGGGGCTGATGAAGAAGGGGGTGGGGGGAGTTTGTGTTGT
TGTTGCTGCTGTTTGGGTTGTTGGTCTGTGTAACATCCAAGCCAGAGTTTTTAAAGCCTT
CTGGATCCATGGGGGGAGAAGTGATATGGTGAAGGGAAGTGGGGAGTATTTGAACACAGT
TGAATTTTTTCTAAAAAGAAAAAGAGATAAATGAGCTTTCCAGATTTCAGATTCTGTATT
TATCTTCAGATTTTGTCTGCAACTATTTTTTATTTTTTAAAGAAATGAAATATCTTCTCT
GCTTGCAAGCTGATTTGGAAAATTCAGAGAGGGAGTGGAGATTATCTGGACAGCCTCATT
TTACCCCAGAGCATCAGAAGCCTGAAAGAGCAGGTTCTGAGACCTTCCCTGCCCCCAAGC
CTGAGCCCAGCCTTGGAATGCGTGGCTCTCCTGGGGGTGCCTTTGGGCAAAATGCACATC
TGAATGGCCAGGTGCTTCCCAGCAGTCAGAAATTATGGGGGGTGGGGGTGAGAGGGCCCC
CTCATAGCATCTCACCAAATCCACATGGAGGCTTTTTGCAAACAGCAGGCAGTTCCCTTC
TGCAGTGACTCCCTCCTAAGGACGCCCCACAACCCAGCTAGTTAAACGTGAGCATTAAAT
TTTTTTTAAAAAAAATCCCCCTAGTTTCCCAAGACAGCATTTCCATGAATTTAGTCTTCT
GTAAATCACTGGGCATTTCCGTGAGCCCTTTCTGCCTCCACTCTCTTCTCTGTCTTTGCA
GTTTCCTTATCCCCGACCGCGCCCCCCCTTCCAACCCAATCACCCCACAAACAAGATTTC
TAGACCCAGTATAAAATGATCCTTTTAGTGACAGTTTCTTGTTATCTGGCCGATCCACTG
GGGACCGGGCTGCAGCCTTTAAAATTTTTGATCCTGGAGGCCGCCGAGCTGAACTTTCCG
GCAGGACCCGGGCGAGGGGGGCTTAGCCCTTCGTTTCGATCTTCCCACCAACATCCGAGA
GCCTAATCAGCGCGCCCACGGAGGCGCCTTAAGGGCAGTTGGGGAAGATGAGCAGAGCCG
GGAAACAGCAAGAGGTATAGACCCTCTGCAGCACCTCTCCAATTCCGCGGCCCTTCCGGG
TGGCGTATACAGCTCCAGGATTGGGAAAGGGGCTCCGGTGGCCCGGCCCGCGGGCGCCTG
GCCTCGAAGCCAGAGGGAGGAGTGCGGGGCGTGGGGTCGGGGGGTGCCGGGCAGAGGAGG
AAGCCGTGTCCGGGTCCGCTGGGCGAGGGGTCCTGGGTCAGGGGTCCTGGGTCAGGGCCG
GTCTGAGCCCCGGTGCCCCGCAGGTCTCCCCGCGCCCCGGCCGCGCCCACAGGCCCGCCC
CCTAGCCGCCGGGGTTGCTATGCGTTGCCGTGAAACGCCTGTCAATAAACCCTGTTTGGA
CAGTGGAGCAAGAGCACATGGGTTGTTTGCTTAGTGGTTAGAGGTTCAAAAGTCGACATT
GTCCCGCTGCAAGCGATTACAAGTTCTTCCCCTTCCCGGGGCTCGGTCCCCTTGCACGCG
GGTACGGGGCCAGGGAAGGGAGCTCGGCTGCTCTCTGAGATGCAAGCACCCGGCTCGCTG
CTGCGAGCGCCTGGCAAGCCTCCCGGGCCACGGAAAAAGGCGCAAAACCAAGACCCTCTC
CGGCAAGTGAGGCCACCGCGCTTCTAACGCCAACTGTGTCACCCCCGAAGCAATACCTAC
GGAACAAGGGATGTGGCACGAGTAGGGAGCGCAGCTTGAGGAGTGTAGGGAGGCCTGCAC
AGGGGCGCCTGAGGTTGAGACCGGATGACCTCGCGGCTCCTGACGCCTCCAGCGCAGAGC
TTGGGGTCCCGGCCTCCGAATCCCACGCCTCCACCGCGTCCAGTCGCCGGTTCAGGCGCC
AGAGGGCGCGCGCGCTCTGGGAAGAGATGGGGCTTGGGCTCGTGAACCCGGAAAGGTTCC
AGTTTTCACCCAGTTGGGAGGTGCAAGCGCCTCTGCCGACTCCGGCTGAGCCCAAACCCG
GGCGCTGCAAGATTTTTCTACGTTGGTCGTGGGCCTGTTGAAACTAAGTTAAAACTAAGT
CAGGCAGGAGAGATTCTTGGGTTTGTTGAATGTTTAAGAAAAACAAAATTGGGGGAGAGG
GACTATACCATTCTAAAAGGGTCATTTTGCACACGATGTTTTCTTTCTAAAAATTACAGT
AATGTGGGCACAGTATTAATATATGGTAATACTAGAAATTTAGGATAAATATGAGAATAA
AACCTGTCAATATTGTGGAACAGAGGTT

Protein Sequence

>1045 : length: 321
MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQS
PGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPH
HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ
ALTSPSSTVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKI
WFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASV
PGSVPGVLGPTGGVLNPTVTQ