ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10432

Name

RBM14

Synonym

COAA|PSP2|SIP|SYTIP1|TMEM137;RNA binding motif protein 14;RBM14;RNA binding motif protein 14

Definition

RNA-binding protein 14|RRM-containing coactivator activator/modulator|SYT-interacting protein|paraspeckle protein 2|synaptotagmin-interacting protein|transmembrane protein 137

Position

11q13.2

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10432

Links to epithelial mesenchymal transition gene database

10432

Links to ovarian cancer gene database

10432

Links to endometrial cancer gene database

10432

Links to iHOP

10432

Sequence Information

Nucleotide Sequence

>10432 : length: 5415
ATTGGCTAGGCCAGGGCGCCTGCGCGGCGGGGTTCTCGGTCGCCAGCCATTCCTGAGGAG
GACTGCCGGTCGTTCGGACGTCTTGCCTGTCGCTGGAGGAGAGGTCCGGGCTCTCCAGGA
AGGTGGCTGCGGCGACAAAATGAAGATATTCGTGGGCAACGTCGACGGGGCGGATACGAC
TCCGGAGGAGCTGGCAGCCCTCTTTGCGCCCTACGGCACGGTCATGAGCTGCGCCGTCAT
GAAACAGTTCGCCTTCGTGCACATGCGCGAGAACGCGGGCGCGCTGCGCGCCATCGAAGC
CCTGCACGGCCACGAGCTGCGGCCGGGGCGCGCGCTCGTGGTGGAGATGTCGCGCCCAAG
GCCTCTTAATACTTGGAAGATTTTCGTGGGCAATGTGTCGGCTGCATGCACGAGCCAGGA
ACTGCGCAGCCTCTTCGAGCGCCGCGGACGCGTCATCGAGTGTGACGTGGTGAAAGACTA
CGCGTTTGTTCACATGGAGAAGGAAGCAGATGCCAAAGCCGCAATCGCGCAGCTCAACGG
CAAAGAAGTGAAGGGCAAGCGCATCAACGTGGAACTCTCCACCAAGGGTCAGAAGAAGGG
GCCTGGCCTGGCTGTCCAGTCTGGGGACAAGACCAAGAAACCAGGGGCTGGGGATACGGC
CTTCCCTGGAACTGGTGGCTTCTCTGCCACCTTCGACTACCAGCAGGCTTTTGGCAACAG
CACTGGTGGCTTTGATGGGCAAGCCCGTCAGCCCACACCACCCTTCTTTGGTCGCGACCG
CAGCCCTCTGCGCCGTTCACCTCCCCGAGCCTCTTATGTGGCTCCTCTGACGGCCCAGCC
AGCTACCTACCGGGCCCAGCCGTCCGTGTCACTGGGAGCTGCCTACAGGGCCCAGCCTTC
TGCCTCTTTGGGTGTTGGCTATCGGACTCAGCCCATGACAGCCCAGGCAGCCTCTTACCG
CGCTCAGCCCTCTGTCTCCCTTGGGGCACCATACAGGGGCCAGCTGGCTAGTCCTAGCTC
CCAGTCTGCTGCAGCTTCTTCACTCGGCCCATATGGTGGAGCCCAGCCCTCAGCCTCGGC
CCTTTCCTCCTATGGGGGTCAGGCAGCTGCAGCTTCTTCGCTCAACTCCTATGGGGCTCA
GGGTTCCTCCCTTGCCTCCTATGGTAACCAGCCATCCTCTTACGGCGCCCAGGCTGCCTC
TTCCTATGGGGTTCGTGCAGCTGCTTCTTCCTACAACACCCAGGGAGCAGCTTCCTCCTT
AGGCTCCTACGGGGCTCAGGCAGCCTCCTATGGGGCCCAGTCTGCAGCCTCCTCACTAGC
TTATGGAGCCCAGGCAGCTTCATATAATGCCCAGCCCTCGGCCTCTTACAATGCCCAGTC
TGCCCCATATGCTGCACAGCAGGCTGCTTCCTACTCTTCCCAACCTGCTGCCTATGTGGC
ACAGCCAGCCACAGCTGCTGCCTATGCCAGCCAGCCAGCAGCCTACGCCGCACAAGCCAC
TACCCCAATGGCTGGCTCCTATGGGGCCCAGCCGGTTGTGCAGACCCAGCTGAATAGTTA
CGGGGCCCAAGCATCAATGGGCCTTTCAGGCTCCTATGGGGCTCAGTCGGCTGCTGCGGC
CACTGGCTCCTATGGTGCCGCAGCAGCCTACGGGGCCCAACCTTCTGCCACCCTGGCAGC
TCCTTACCGCACTCAGTCATCAGCCTCATTGGCTGCTTCCTATGCTGCCCAGCAGCATCC
CCAGGCTGCTGCCTCCTACCGCGGCCAGCCAGGCAATGCCTACGATGGGGCAGGTCAGCC
GTCTGCAGCCTACCTGTCCATGTCCCAGGGGGCCGTTGCCAACGCCAACAGCACCCCGCC
GCCCTATGAGCGTACCCGCCTCTCCCCACCCCGGGCCAGCTACGACGATCCCTACAAAAA
GGCTGTCGCCATGTCGAAAAGGTATGGTTCCGACCGGCGTTTAGCCGAGCTCTCTGATTA
CCGCCGTTTATCAGAGTCGCAGCTTTCGTTCCGCCGCTCGCCGACAAAGTCCTCGCTGGA
TTACCGTCGCCTGCCCGATGCCCATTCCGATTACGCACGCTATTCGGGCTCCTATAATGA
TTACCTGCGGGCGGCTCAGATGCACTCTGGCTACCAGCGCCGCATGTAGGGCCATCCTGG
GATGGGGCACCACAGGGAGGGAGGGAGAAAAGAGGTGGGTAGGGTTACAGATCCAGGTTA
TAACTACTCTGGCCCATACCTTTCCTGGTTGTGGTTTTTCATGCCCTCTACCATGTGGGC
CTTCCCCAGGAGATGATCCTGTTAAGTGTTCGGCAGTAACCTACTTTGTTCCTTCGCCTC
AGCAGCAAATCTTGCTACTGGCTCTAGATCTGCGGTTTCCCCTCTACCCTGCCTCCCGTC
TCCCCAGAATGGGAATTTCTTTTATGTTTTTATTTTTTTCCTGGCTCCCTTTTATTTTTG
TGCGCGATATTTAAGGTCGTCTGGATGGGGAAGCAACCTGCAGCTGAGGTCGCCGGCGCC
TTTTTCTTTTTAGATGGGAAGGAGGCCAGGAAAGGGTCAGCTTAACCATTTCCTATGTGC
CAAGCTGTGCCAGCAGTCCAGGGTACCCTGACTGTCCCTCTGTAGACTGTTGAGACTGAG
TTCCTGTTGGGACAGTCAGTTGGTATGTATCCAAGTCCCTGCTGACCACTAATGTTCTAG
CTGATGGTGAGCGGCACAGTCCCACTTCCCCATCTCCCCAAGTAGGTGGTGTTAGAAAAC
CTTAATTTTTTTTCCCTTTTGTATGGACTACAAATAAAACTTGGGGCAATTTGCAGTTTG
GAAACCTGGTTGTCATTGTCTTGATTGCATTCAGTGTCAAAGGAGCCAATTTGACATCCA
GGAAGACATGATAGCTAAAGGGAAGGCAGTCAGAGAACCCAGGACTGGTGAGGAAAGGGG
TTTGAATGTCGGAATTAGAAGGATTGCCCTGTGGCCCAGAAGGATTTAGCTCATCGTCGT
CCTGCTAGCCTGCCATCTTTCAGACTTTCCAGGGCAGGTGGCCTGGTCCTCAGCCCTCAA
CTTGAGTTAGTCACACCAAAATGCAGTAAATGATGCCCATTTTCCTCTGCCTGTGCTTGA
CCATTTTCACTGACTTTTCTCCAGTTCAGGAATAACCTGTGTTCCAATGGGATGGTTCTG
GGGTTTGGCCTCTTAGGAAGTGGGGAATGGGCTGCTGTGGTATTTACAGGCTAGTAGATC
CTTTAGGCAGTAGGCTGGAATGAGTGCTGGGGCTGGGACCCAGAAAGGAACCAGTAGTGG
AGTGGGGGTAATGGCGTTGCCTGATACTGCCCTATGGTTGGAATAAGGAAGGGCAGAGAA
AACTTGAAGCAGGTATGGGGCATTCTGGCCATAGAGCTCGTATTTTGCCTGTTGAGCTGT
ACCATGGAGCATCCTCCTGTGTCCTGCCAACCCCTGCCATTATAGTCACCGGAGACTCCT
TTACCTATCCCTATCTGTTAGGGTTTTCAGATGTCCTCTCGCTGGGTTTATATTTGAAGG
TATAGAATCTGGGAAAGGGTGGGGTGCAAGCTAACCAAATAGGGATGCTAGGGTTGGGTG
GGGAATTGAGGACTCTTCTGTGCTTTTATTGTAGGGCTGGGGATCGAGGATCTGGGCAAA
AAATATGACATTTCCAACCAGGGACAAAATGGAGGCTTGGGCTTAGTGATGGGTAAATGG
AAGACTGGTTGAGTGGGATGATAATGGGAGAACTTACTGATGCTCTTTTGGGAAAAGGTG
CTTTAAAGACTCGATTTGGGAGCCTACTGGGGCAAGGCGACTGGGGAGGTGTACGTGTTA
GTCAAGTGGAGGTCAGGTGGGTTATCTTCTGCCTCCTTCACTGGCTTCATGTGAACTTGC
CTGTGACAGAATATCTTGCCCTAGATGTCCTCTTCCCTCTTGCCATCGTGCAAAAGCATT
CGATCTTATGACCGTGAGTTCTTATTTGTGGATGCTAACTGGGGTAATCTCAGGGAGTAC
TGGGGCCATGGCTCTTTCCCTTGCTTCTCTTTCTGCTCACTGCTTTGCTTTCAGGTGCTT
AGCTGCTCCTTTTTATTTCTTTGCAGGACTGGGAAAGCATGGGAGGAGGATTTTGATAAG
TTTCTTGTTCTCTGCGTGGTGATGGGGTGGTCTGAGGGCCAAGTTAATAAGCCTACCTTT
GGTTATTACCCTGGAAAATTGAGGGTTGATGGTAGGGTTATGATTGTGGCCTGTGTATTT
GCAATTTTTCTTTGTCAGTGTGGCTTTCTGTCATCTTCCTTTTTCTCCAGTGAGGGTTCT
GCCACTGTCTCAATCCCTTGGTTCCTGCAAAAAACAGCTAAATGTGCTCTCAGGGCCAGT
GGTGATGTTCTGTGTTGCAGCCCCAGCTCTTGAAAGTGACCTGGCCCAGATGAGCTCTGC
CTGCTTGTCATCTTTAGGTCCTGCTGCCCCTGCTGCCTCAGCCCTCAGGCTCCTAACTGC
TCAAGCCAGAAGGAGCTACAAAGCCAAATCATTTGTCATTTTTCTCTGGCAGATTGTTTT
AAAATCTCCCTCCCCTCTTTTATTTTAATTATGCCACCTGTGTTAATCCTATAGCCTGCT
TCTTTGCTTTGTGGATTACTGATTTCAAGTTCTATAACTTGGGGAAAGTTAGGTTGAGTG
AATGGGAGGACAGACACTGAATGTGTGTTTTGGAAAAATGGACTCTCTATCTTCAGATTA
TTCAGCTTCTCCACCTATCACCTCTACAACTTGGCCTTCATTGGAGAAGTTTTAGTTGGC
TTATTCCTGGAACAAGACCACCTAGAGGCTTTTAGCCTTGTCAGCCTGCCCTCTTCTGAG
GTTTGGACCTTGTTTTAAATTGTGTGCATGGTGGGCTTGAGACTCTCTTGTAATGGAGGT
AATGGGACTATCACTGAGGGGTTCAGCCTATCCAGGTAGGCTACCGTTCTAGTCATACCC
ATCACTTAAATTCTGCCACAGTCTGCACAGACGGTTGGTCCTCCAGGCATATTGTCCTAT
TAAGCCAAATAGGTGGACATCATGGGATGGATGAGGTCATCATGAAAACAGATTTACTGG
ATTTATGGACCTAGTATATACTATGTAACAGATGGAAAACTGAATTTTACAATCTATAGG
TACCTTTGAAAGGTCATAAAGGGTAAAAGTCTATAGTTTTCCAGAAAATAATTCTTAAAA
CTGGGTTTTATGTCTAGATTTAAATCATGTATCTGTCTGTAGTGCTTCAAATGTGGCCAG
GTGTGGTAGCTCACACCTGTAATTCCCAGCGCTTTGGGAATTTGAGGCAAGAGGATTGCT
AGAGGCCAGGATTTTGAGACCAGCTTCGGCAATACGGTGAGACCTTGTCTCTACCAAAAG
AAAAGAAAAAAAAAA

Protein Sequence

>10432 : length: 669
MKIFVGNVDGADTTPEELAALFAPYGTVMSCAVMKQFAFVHMRENAGALRAIEALHGHEL
RPGRALVVEMSRPRPLNTWKIFVGNVSAACTSQELRSLFERRGRVIECDVVKDYAFVHME
KEADAKAAIAQLNGKEVKGKRINVELSTKGQKKGPGLAVQSGDKTKKPGAGDTAFPGTGG
FSATFDYQQAFGNSTGGFDGQARQPTPPFFGRDRSPLRRSPPRASYVAPLTAQPATYRAQ
PSVSLGAAYRAQPSASLGVGYRTQPMTAQAASYRAQPSVSLGAPYRGQLASPSSQSAAAS
SLGPYGGAQPSASALSSYGGQAAAASSLNSYGAQGSSLASYGNQPSSYGAQAASSYGVRA
AASSYNTQGAASSLGSYGAQAASYGAQSAASSLAYGAQAASYNAQPSASYNAQSAPYAAQ
QAASYSSQPAAYVAQPATAAAYASQPAAYAAQATTPMAGSYGAQPVVQTQLNSYGAQASM
GLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASY
RGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSK
RYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQ
MHSGYQRRM