ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10419

Name

PRMT5

Synonym

HRMT1L5|IBP72|JBP1|SKB1|SKB1Hs;protein arginine methyltransferase 5;PRMT5;protein arginine methyltransferase 5

Definition

72 kDa ICln-binding protein|HMT1 hnRNP methyltransferase-like 5|SKB1 homolog|histone-arginine N-methyltransferase PRMT5|jak-binding protein 1|protein arginine N-methyltransferase 5|shk1 kinase-binding protein 1 homolog

Position

14q11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

snRNP Assembly;PID Reactome;500858

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

p53 pathway;PID Curated;200175

Pathway

Metabolism of RNA;Reactome;REACT:21257

Disease

Stomach cancer;FunDO

Disease

Testicular tumor;FunDO

External Links

Links to cell senescence gene database

10419

Links to epithelial mesenchymal transition gene database

10419

Links to ovarian cancer gene database

10419

Links to endometrial cancer gene database

10419

Links to iHOP

10419

Sequence Information

Nucleotide Sequence

>10419 : length: 2626
AAGTTCGTCAGGAACCAGACCCTGAGATTGGTGGATCCATGCCGTACGCCACTGTGCAGC
CCGCGGATTGGCAGGAAAAGCCACTCCCCATCCCTCCTGTTCGGGAGCTGTGGCAGACGC
TCTGGTTGTTAAGGCGACTCGTCCCGCCTTCTGGGGCACTAGTTTGACTTTGTGATTGGC
TACTAGTATCAAGGAATCCCGGCGTGGACAGCGCGAGGAGAAAGATGGCGGCGATGGCGG
TCGGGGGTGCTGGTGGGAGCCGCGTGTCCAGCGGGAGGGACCTGAATTGCGTCCCCGAAA
TAGCTGACACACTAGGGGCTGTGGCCAAGCAGGGGTGAGGGCCGGACCTCCACGAGCGGA
ATGCGGGGTCCGAACTCGGGGACGGAGAAGGGCAGACTAGTCATCCCGGAGAAGCAGGGG
TTTGATTTCCTCTGCATGCCTGTCTTCCATCCGCGTTTCAAGAGGGAGTTCATTCAGGAA
CCTGCTAAGAATCGGCCCGGTCCCCAGACACGATCAGACCTACTGCTGTCAGGAAGGGAC
TGGAATACGCTAATTGTGGGAAAGCTTTCTCCATGGATTCGTCCAGACTCAAAAGTGGAG
AAGATTCGCAGGAACTCCGAGGCGGCCATGTTACAGGAGCTGAATTTTGGTGCATATTTG
GGTCTTCCAGCTTTCCTGCTGCCCCTTAATCAGGAAGATAACACCAACCTGGCCAGAGTT
TTGACCAACCACATCCACACTGGCCATCACTCTTCCATGTTCTGGATGCGGGTACCCTTG
GTGGCACCAGAGGACCTGAGAGATGATATAATTGAGAATGCACCAACTACACACACAGAG
GAGTACAGTGGGGAGGAGAAAACGTGGATGTGGTGGCACAACTTCCGGACTTTGTGTGAC
TATAGTAAGAGGATTGCAGTGGCTCTTGAAATTGGGGCTGACCTCCCATCTAATCATGTC
ATTGATCGCTGGCTTGGGGAGCCCATCAAAGCAGCCATTCTCCCCACTAGCATTTTCCTG
ACCAATAAGAAGGGATTTCCTGTTCTTTCTAAGATGCACCAGAGGCTCATCTTCCGGCTC
CTCAAGTTGGAGGTGCAGTTCATCATCACAGGCACCAACCACCACTCAGAGAAGGAGTTC
TGCTCCTACCTCCAATACCTGGAATACTTAAGCCAGAACCGTCCTCCACCTAATGCCTAT
GAACTCTTTGCCAAGGGCTATGAAGACTATCTGCAGTCCCCGCTTCAGCCACTGATGGAC
AATCTGGAATCTCAGACATATGAAGTGTTTGAAAAGGACCCCATCAAATACTCTCAGTAC
CAGCAGGCCATCTATAAATGTCTGCTAGACCGAGTACCAGAAGAGGAGAAGGATACCAAT
GTCCAGGTACTGATGGTGCTGGGAGCAGGACGGGGACCCCTGGTGAACGCTTCCCTGCGG
GCAGCCAAGCAGGCCGACCGGCGGATAAAGCTGTATGCTGTGGAGAAAAACCCAAATGCC
GTGGTGACGCTAGAGAACTGGCAGTTTGAAGAATGGGGAAGCCAAGTGACCGTAGTCTCA
TCAGACATGAGGGAATGGGTGGCTCCAGAGAAAGCAGACATCATTGTCAGTGAGCTTCTG
GGCTCATTTGCTGACAATGAATTGTCGCCTGAGTGCCTGGATGGAGCCCAGCACTTCCTA
AAAGATGATGGTGTGAGCATCCCCGGGGAGTACACTTCCTTTCTGGCTCCCATCTCTTCC
TCCAAGCTGTACAATGAGGTCCGAGCCTGTAGGGAGAAGGACCGTGACCCTGAGGCCCAG
TTTGAGATGCCTTATGTGGTACGGCTGCACAACTTCCACCAGCTCTCTGCACCCCAGCCC
TGTTTCACCTTCAGCCATCCCAACAGAGATCCTATGATTGACAACAACCGCTATTGCACC
TTGGAATTTCCTGTGGAGGTGAACACAGTACTACATGGCTTTGCCGGCTACTTTGAGACT
GTGCTTTATCAGGACATCACTCTGAGTATCCGTCCAGAGACTCACTCTCCTGGGATGTTC
TCATGGTTTCCCATCCTCTTCCCTATTAAGCAGCCCATAACGGTACGTGAAGGCCAAACC
ATCTGTGTGCGTTTCTGGCGATGCAGCAATTCCAAGAAGGTGTGGTATGAGTGGGCTGTG
ACAGCACCAGTCTGTTCTGCTATTCATAACCCCACAGGCCGCTCATATACCATTGGCCTC
TAGCCCTGCGTGCCAAGTGTCCAGAGCCTTGGAAGCAGCTTCAGGTTCTGCTCCTGTAGT
ACAGAAGGTGCAGTACATCTATGGGCTGTGATTCCCCTTGCCCATCAGAGAGGAGCATTT
CAATCTGCTTTCCTGCCTTACATCAAGGTGGGCAAGGGATTATAATTAATTGCAGGGCTC
AAGCCACCAATCTATGAAGACCTCAGGCCAGGGGGTGAGGAATTAGTGCTGGATTTGAAG
CTACGCACTCAGCCTCAAGAACTCCCTGGAATATCCCTGAGAACATGGGGTTTGAACGGA
TTTTCAGCCTTTTTCTGTTCTTGTTTTGATGGTTTTGTGTAAGAGGAAATACAAATAAAG
TTATAGCCCTTTACTGCACGACCATGCTGCCCCCTGAAAAAAAAAA

Protein Sequence

>10419 : length: 637
MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAK
NRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLP
AFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYS
GEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNK
KGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELF
AKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQV
LMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDM
REWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKL
YNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEF
PVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICV
RFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL