ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10413

Name

YAP1

Synonym

COB1|YAP|YAP2|YAP65|YKI;Yes-associated protein 1;YAP1;Yes-associated protein 1

Definition

65 kDa Yes-associated protein|protein yorkie homolog|transcriptional coactivator YAP1|yes-associated protein 2|yes-associated protein YAP65 homolog|yorkie homolog

Position

11q13

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

ErbB4 signaling events;PID Curated;200009

Disease

Cancer;FunDO

External Links

Links to cell senescence gene database

10413

Links to epithelial mesenchymal transition gene database

10413

Links to ovarian cancer gene database

10413

Links to endometrial cancer gene database

10413

Links to iHOP

10413

Sequence Information

Nucleotide Sequence

>10413 : length: 5610
CGGGAGAGGCGCCGCGGGCCGGGAGTGTGCAGGAATGTAGCAACTTGCAGCGAAAAGTTT
CCCTGCGCTGCCGGCCGGGCCGCGGTGCGGGCGGGCGCGCAGAGGAAGGAAGAGCCGAGA
GGAGGCGGGGCCGCGGCGGCGCGGGCGGGCGCTTCTCCTAACTTTAGTTTTGGCGTTTGA
GGCGAGTTTCTGTCTCAGTCGGGCGCAGCCGCCGCCAGGGAAAAGAAAGGGAGGAAGGAA
GGAACAAGAAAAGGAAATAAAGAGAAAGGGGAGGCGGGGAAAGGCAACGAGCTGTCCGGC
CTCCGTCAAGGGAGTTGGAGGGAAAAAGTTCTCAGGCGCCGCAGGTCCGAGTGCCTCGCA
GCCCCTCCCGAGGCGCAGCCGCCAGACCAGTGGAGCCGGGGCGCAGGGCGGGGGCGGAGG
CGCCGGGGCGGGGGATGCGGGGCCGCGGCGCAGCCCCCCGGCCCTGAGAGCGAGGACAGC
GCCGCCCGGCCCGCAGCCGTCGCCGCTTCTCCACCTCGGCCCGTGGAGCCGGGGCGTCCG
GGCGTAGCCCTCGCTCGCCTGGGTCAGGGGGTGCGCGTCGGGGGAGGCAGAAGCCATGGA
TCCCGGGCAGCAGCCGCCGCCTCAACCGGCCCCCCAGGGCCAAGGGCAGCCGCCTTCGCA
GCCCCCGCAGGGGCAGGGCCCGCCGTCCGGACCCGGGCAACCGGCACCCGCGGCGACCCA
GGCGGCGCCGCAGGCACCCCCCGCCGGGCATCAGATCGTGCACGTCCGCGGGGACTCGGA
GACCGACCTGGAGGCGCTCTTCAACGCCGTCATGAACCCCAAGACGGCCAACGTGCCCCA
GACCGTGCCCATGAGGCTCCGGAAGCTGCCCGACTCCTTCTTCAAGCCGCCGGAGCCCAA
ATCCCACTCCCGACAGGCCAGTACTGATGCAGGCACTGCAGGAGCCCTGACTCCACAGCA
TGTTCGAGCTCATTCCTCTCCAGCTTCTCTGCAGTTGGGAGCTGTTTCTCCTGGGACACT
GACCCCCACTGGAGTAGTCTCTGGCCCAGCAGCTACACCCACAGCTCAGCATCTTCGACA
GTCTTCTTTTGAGATACCTGATGATGTACCTCTGCCAGCAGGTTGGGAGATGGCAAAGAC
ATCTTCTGGTCAGAGATACTTCTTAAATCACATCGATCAGACAACAACATGGCAGGACCC
CAGGAAGGCCATGCTGTCCCAGATGAACGTCACAGCCCCCACCAGTCCACCAGTGCAGCA
GAATATGATGAACTCGGCTTCAGGTCCTCTTCCTGATGGATGGGAACAAGCCATGACTCA
GGATGGAGAAATTTACTATATAAACCATAAGAACAAGACCACCTCTTGGCTAGACCCAAG
GCTTGACCCTCGTTTTGGTAAAGCCATGAACCAGAGAATCAGTCAGAGTGCTCCAGTGAA
ACAGCCACCACCCCTGGCTCCCCAGAGCCCACAGGGAGGCGTCATGGGTGGCAGCAACTC
CAACCAGCAGCAACAGATGCGACTGCAGCAACTGCAGATGGAGAAGGAGAGGCTGCGGCT
GAAACAGCAAGAACTGCTTCGGCAGGTGAGGCCACAGGCAATGCGGAATATCAATCCCAG
CACAGCAAATTCTCCAAAATGTCAGGAGTTAGCCCTGCGTAGCCAGTTACCAACACTGGA
GCAGGATGGTGGGACTCAAAATCCAGTGTCTTCTCCCGGGATGTCTCAGGAATTGAGAAC
AATGACGACCAATAGCTCAGATCCTTTCCTTAACAGTGGCACCTATCACTCTCGAGATGA
GAGTACAGACAGTGGACTAAGCATGAGCAGCTACAGTGTCCCTCGAACCCCAGATGACTT
CCTGAACAGTGTGGATGAGATGGATACAGGTGATACTATCAACCAAAGCACCCTGCCCTC
ACAGCAGAACCGTTTCCCAGACTACCTTGAAGCCATTCCTGGGACAAATGTGGACCTTGG
AACACTGGAAGGAGATGGAATGAACATAGAAGGAGAGGAGCTGATGCCAAGTCTGCAGGA
AGCTTTGAGTTCTGACATCCTTAATGACATGGAGTCTGTTTTGGCTGCCACCAAGCTAGA
TAAAGAAAGCTTTCTTACATGGTTATAGAGCCCTCAGGCAGACTGAATTCTAAATCTGTG
AAGGATCTAAGGAGACACATGCACCGGAAATTTCCATAAGCCAGTTGCAGTTTTCAGGCT
AATACAGAAAAAGATGAACAAACGTCCAGCAAGATACTTTAATCCTCTATTTTGCTCTTC
CTTGTCCATTGCTGCTGTTAATGTATTGCTGACCTCTTTCACAGTTGGCTCTAAAGAATC
AAAAGAAAAAAACTTTTTATTTCTTTTGCTATTAAAACTACTGTTCATTTTGGGGGCTGG
GGGAAGTGAGCCTGTTTGGATGATGGATGCCATTCCTTTTGCCCAGTTAAATGTTCACCA
ATCATTTTAACTAAATACTCAGACTTAGAAGTCAGATGCTTCATGTCACAGCATTTAGTT
TGTTCAACAGTTGTTTCTTCAGCTTCCTTTGTCCAGTGGAAAAACATGATTTACTGGTCT
GACAAGCCAAAAATGTTATATCTGATATTAAATACTTAATGCTGATTTGAAGAGATAGCT
GAAACCAAGGCTGAAGACTGTTTTACTTTCAGTATTTTCTTTTCCTCCTAGTGCTATCAT
TAGTCACATAATGACCTTGATTTTATTTTAGGAGCTTATAAGGCATGAGACAATTTCCAT
ATAAATATATTAATTATTGCCACATACTCTAATATAGATTTTGGTGGATAATTTTGTGGG
TGTGCATTTTGTTCTGTTTTGTTGGGTTTTTTGTTTTTTTTGTTTTTGGCAGGGTCGGTG
GGGGGGTTGGTTGGTTGGTTGGTTTTGTCGGAACCTAGGCAAATGACCATATTAGTGAAT
CTGTTAATAGTTGTAGCTTGGGATGGTTATTGTAGTTGTTTTGGTAAAATCTTCATTTCC
TGGTTTTTTTTACCACCTTATTTAAATCTCGATTATCTGCTCTCTCTTTTATATACATAC
ACACACCCAAACATAACATTTATAATAGTGTGGTAGTGGAATGTATCCTTTTTTAGGTTT
CCCTGCTTTCCAGTTAATTTTTAAAATGGTAGCGCTTTGTATGCATTTAGAATACATGAC
TAGTAGTTTATATTTCACTGGTAGTTTAAATCTGGTTGGGGCAGTCTGCAGATGTTTGAA
GTAGTTTAGTGTTCTAGAAAGAGCTATTACTGTGGATAGTGCCTAGGGGAGTGCTCCACG
CCCTCTGGGCATACGGTAGATATTATCTGATGAATTGGAAAGGAGCAAACCAGAAATGGC
TTTATTTTCTCCCTTGGACTAATTTTTAAGTCTCGATTGGAATTCAGTGAGTAGGTTCAT
AATGTGCATGACAGAAATAAGCTTTATAGTGGTTTACCTTCATTTAGCTTTGGAAGTTTT
CTTTGCCTTAGTTTTGGAAGTAAATTCTAGTTTGTAGTTCTCATTTGTAATGAACACATT
AACGACTAGATTAAAATATTGCCTTCAAGATTGTTCTTACTTACAAGACTTGCTCCTACT
TCTATGCTGAAAATTGACCCTGGATAGAATACTATAAGGTTTTGAGTTAGCTGGAAAAGT
GATCAGATTAATAAATGTATATTGGTAGTTGAATTTAGCAAAGAAATAGAGATAATCATG
ATTATACCTTTATTTTTACAGGAAGAGATGATGTAACTAGAGTATGTGTCTACAGGAGTA
ATAATGGTTTCCAAAGAGTATTTTTTAAAGGAACAAAACGAGCATGAATTAACTCTTCAA
TATAAGCTATGAAGTAATAGTTGGTTGTGAATTAAAGTGGCACCAGCTAGCACCTCTGTG
TTTTAAGGGTCTTTCAATGTTTCTAGAATAAGCCCTTATTTTCAAGGGTTCATAACAGGC
ATAAAATCTCTTCTCCTGGCAAAAGCTGCTATGAAAAGCCTCAGCTTGGGAAGATAGATT
TTTTTCCCCCCAATTACAAAATCTAAGTATTTTGGCCCTTCAATTTGGAGGAGGGCAAAA
GTTGGAAGTAAGAAGTTTTATTTTAAGTACTTTCAGTGCTCAAAAAAATGCAATCACTGT
GTTGTATATAATAGTTCATAGGTTGATCACTCATAATAATTGACTCTAAGGCTTTTATTA
AGAAAACAGCAGAAAGATTAAATCTTGAATTAAGTCTGGGGGGAAATGGCCACTGCAGAT
GGAGTTTTAGAGTAGTAATGAAATTCTACCTAGAATGCAAAATTGGGTATATGAATTACA
TAGCATGTTGTTGGGATTTTTTTTAATGTGCAGAAGATCAAAGCTACTTGGAAGGAGTGC
CTATAATTTGCCAGTAGCCACAGATTAAGATTATATCTTATATATCAGCAGATTAGCTTT
AGCTTAGGGGGAGGGTGGGAAAGTTTGGGGGGGGGGTTGTGAAGATTTAGGGGGACCTTG
ATAGAGAACTTTATAAACTTCTTTCTCTTTAATAAAGACTTGTCTTACACCGTGCTGCCA
TTAAAGGCAGCTGTTCTAGAGTTTCAGTCACCTAAGTACACCCACAAAACAATATGAATA
TGGAGATCTTCCTTTACCCCTCAACTTTAATTTGCCCAGTTATACCTCAGTGTTGTAGCA
GTACTGTGATACCTGGCACAGTGCTTTGATCTTACGATGCCCTCTGTACTGACCTGAAGG
AGACCTAAGAGTCCTTTCCCTTTTTGAGTTTGAATCATAGCCTTGATGTGGTCTCTTGTT
TTATGTCCTTGTTCCTAATGTAAAAGTGCTTAACTGCTTCTTGGTTGTATTGGGTAGCAT
TGGGATAAGATTTTAACTGGGTATTCTTGAATTGCTTTTACAATAAACCAATTTTATAAT
CTTTAAATTTATCAACTTTTTACATTTGTGTTATTTTCAGTCAGGGCTTCTTAGATCTAC
TTATGGTTGATGGAGCACATTGATTTGGAGTTTCAGATCTTCCAAAGCACTATTTGTTGT
AATAACTTTTCTAAATGTAGTGCCTTTAAAGGAAAAATGAACACAGGGAAGTGACTTTGC
TACAAATAATGTTGCTGTGTTAAGTATTCATATTAAATACATGCCTTCTATATGGAACAT
GGCAGAAAGACTGAAAAATAACAGTAATTAATTGTGTAATTCAGAATTCATACCAATCAG
TGTTGAAACTCAAACATTGCAAAAGTGGGTGGCAATATTCAGTGCTTAACACTTTTCTAG
CGTTGGTACATCTGAGAAATGAGTGCTCAGGTGGATTTTATCCTCGCAAGCATGTTGTTA
TAAGAATTGTGGGTGTGCCTATCATAACAATTGTTTTCTGTATCTTGAAAAAGTATTCTC
CACATTTTAAATGTTTTATATTAGAGAATTCTTTAATGCACACTTGTCAAATATATATAT
ATAGTACCAATGTTACCTTTTTATTTTTTGTTTTAGATGTAAGAGCATGCTCATATGTTA
GGTACTTACATAAATTGTTACATTATTTTTTCTTATGTAATACCTTTTTGTTTGTTTATG
TGGTTCAAATATATTCTTTCCTTAAACTCT

Protein Sequence

>10413 : length: 510
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGD
SETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTP
QHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMA
KTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAM
TQDGEIYYINHKNKTTSWLDPRLDPRFGKAMNQRISQSAPVKQPPPLAPQSPQGGVMGGS
NSNQQQQMRLQQLQMEKERLRLKQQELLRQVRPQAMRNINPSTANSPKCQELALRSQLPT
LEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPD
DFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSL
QEALSSDILNDMESVLAATKLDKESFLTWL