ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10365

Name

KLF2

Synonym

LKLF;Kruppel-like factor 2;KLF2;Kruppel-like factor 2

Definition

Krueppel-like factor 2|Kruppel-like factor 2 (lung)|Kruppel-like factor LKLF|lung Kruppel-like zinc finger transcription factor|lung krueppel-like factor

Position

19p13.11

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10365

Links to epithelial mesenchymal transition gene database

10365

Links to ovarian cancer gene database

10365

Links to endometrial cancer gene database

10365

Links to iHOP

10365

Sequence Information

Nucleotide Sequence

>10365 : length: 1655
GCCCGCCCGCGCCCCGACCAGCCCGGCCTCGGGCAGCCACTCACCGGTGTCCCCGTCCGC
GTCCTTCCTCCCCGGGTCCCGGCCATGGCGCTGAGTGAACCCATCCTGCCGTCCTTCTCC
ACTTTCGCCAGCCCGTGCCGCGAGCGCGGCCTGCAGGAGCGCTGGCCGCGCGCCGAACCC
GAGTCCGGCGGCACCGACGACGACCTCAACAGCGTGCTGGACTTCATCCTGTCCATGGGG
CTGGATGGCCTGGGCGCCGAGGCCGCCCCGGAGCCGCCGCCGCCGCCCCCGCCGCCTGCG
TTCTATTACCCCGAACCCGGCGCGCCCCCGCCCTACAGCGCCCCCGCGGGTGGCCTGGTG
TCTGAGCTGCTGCGACCCGAGCTGGATGCGCCGCTGGGGCCCGCACTGCACGGCCGCTTT
CTGCTGGCGCCGCCCGGCCGCCTGGTCAAGGCCGAGCCCCCTGAAGCGGACGGCGGCGGC
GGCTACGGCTGCGCCCCCGGGCTGACCCGTGGACCGCGCGGCCTCAAGCGCGAGGGCGCC
CCGGGCCCGGCGGCTTCGTGCATGCGAGGTCCCGGGGGCCGCCCCCCGCCGCCGCCCGAC
ACACCGCCGCTCAGCCCCGACGGCCCCGCGCGCCTGCCCGCGCCCGGTCCGCGCGCCTCC
TTCCCGCCGCCTTTCGGTGGCCCTGGTTTCGGCGCGCCCGGGCCCGGCCTGCATTACGCG
CCGCCTGCGCCCCCAGCCTTCGGTCTCTTCGACGACGCGGCCGCCGCCGCGGCAGCCCTG
GGCCTGGCGCCCCCCGCCGCCCGCGGTCTCCTCACGCCGCCTGCGTCCCCGCTGGAGCTG
CTGGAGGCCAAGCCAAAGCGCGGCCGCCGCTCTTGGCCCCGCAAACGCACCGCCACTCAC
ACCTGCAGCTACGCGGGCTGCGGCAAGACCTACACCAAGAGTTCGCATCTGAAGGCGCAT
CTGCGCACGCACACAGGTGAGAAGCCCTACCACTGCAACTGGGACGGCTGCGGCTGGAAG
TTTGCGCGCTCAGACGAGCTCACGCGCCACTACCGAAAGCACACGGGCCACCGGCCATTC
CAGTGCCATCTGTGCGATCGTGCCTTCTCGCGCTCCGATCACCTGGCGCTGCACATGAAA
CGGCACATGTAGCCGGGACGCCCCCGCCCACCTGCGCGCGGCCGTGGCGGGTCCCACGCG
CCGGGCGCGGCCCCCTCCCAAACTGTGACTGGTATTTATTGGACCCAGAGAACCGGGCCG
GGCACAGCGTGGCTACAGAGGGTCTCCCTCGATGACGACGACGACGACGCCACCACCCCA
GCCCCCGTCTGTGACTGAAGGCCCGGTGGGAAAAGACCACGATCCTCCTTGACGAGTTTT
GTTTTTCAAAATGGTGCAATAATTTAAGTGGCATCTTCTCTCCCACCGGGTCTACACTAG
AGGATCGAGGCTTGTGATGCCTTGTGAGAAATAAGGGCCTTAATTTGTACTGTCTGCGGC
ATTTTTTATAATATTGTATATAGTGACTGACAAATATTGTATTACTGTACATAGAGAGAC
AGGTGGGCATTTTTGGGCTACCTGGTTCGTTTTTATAAGATTTTGCTGGGTTGGTTTTTT
TTTTAATTAAAAAGTTTTGCATCTTTTAAAAAAAA

Protein Sequence

>10365 : length: 355
MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEA
APEPPPPPPPPAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRL
VKAEPPEADGGGGYGCAPGLTRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDG
PARLPAPGPRASFPPPFGGPGFGAPGPGLHYAPPAPPAFGLFDDAAAAAAALGLAPPAAR
GLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCGKTYTKSSHLKAHLRTHTGEK
PYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM