ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10342

Name

TFG

Synonym

HMSNP|SPG57|TF6|TRKT3;TRK-fused gene;TFG;TRK-fused gene

Definition

TRK-fused gene protein|TRKT3 oncogene|protein TFG

Position

3q12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Thyroid cancer;KEGG PATHWAY;hsa05216

Disease

Thyroid cancer;KEGG DISEASE;H00032

Disease

Cancers;KEGG DISEASE

Disease

Sarcoma;FunDO

Disease

Chondrosarcoma;FunDO

Disease

Cancers of endocrine organs;KEGG DISEASE

Disease

Chondrosarcoma, extraskeletal myxoid;OMIM

External Links

Links to cell senescence gene database

10342

Links to epithelial mesenchymal transition gene database

10342

Links to ovarian cancer gene database

10342

Links to endometrial cancer gene database

10342

Links to iHOP

10342

Sequence Information

Nucleotide Sequence

>10342 : length: 2090
TTCCTAAATCCCGTCATCCAGTGAGAAAGCAGGGACTCTTCGGCCTAGGCAGCCGGGACC
CAGCCAGCCCTGCGCCTCGCGCCGTCGCGCATGCGTCCTGGGTATGTCCACGCGCAATAA
GGAGGGGCGAAAGGACATTTTTTTTTTTCTTGCTCCCGCCTCTGTTCTTCCCCCACCTGC
CACGTACAGAGCCCAAGTTCTCGCTAGGCTTGTTGGGTCAGCGCGATTGGCCGGGGCCCG
CGCGAGCCTGCGAGCGAGGTGCGGCGGTCGCGAAGGGCAACCGAGGGGGCCGTGACCACC
GCCTCCCCGCGACGCCCCAGTCCAGTGGCCTCGCGTCCGCCCATTCAGCGGAGACCTGCG
GAGAGGCGGCGGCCGCGGCCTCCGCAAGCCGTCTTTCTCTAGAGTTGTATATATAGAACA
TCCTGGAGTCCACCATGAACGGACAGTTGGATCTAAGTGGGAAGCTAATCATCAAAGCTC
AACTTGGGGAGGATATTCGGCGAATTCCTATTCATAATGAAGATATTACTTATGATGAAT
TAGTGCTAATGATGCAACGAGTTTTCAGAGGAAAACTTCTGAGTAATGATGAAGTAACAA
TAAAGTATAAAGATGAAGATGGAGATCTTATAACAATTTTTGATAGTTCTGACCTTTCCT
TTGCAATTCAGTGCAGTAGGATACTGAAACTGACATTATTTGTTAATGGCCAGCCAAGAC
CCCTTGAATCAAGTCAGGTGAAATATCTCCGTCGAGAACTGATAGAACTTCGAAATAAAG
TGAATCGTTTATTGGATAGCTTGGAACCACCTGGAGAACCAGGACCTTCCACCAATATTC
CTGAAAATGATACTGTGGATGGTAGGGAAGAAAAGTCTGCTTCTGATTCTTCTGGAAAAC
AGTCTACTCAGGTTATGGCAGCAAGTATGTCTGCTTTTGATCCTTTAAAAAACCAAGATG
AAATCAATAAAAATGTTATGTCAGCGTTTGGCTTAACAGATGATCAGGTTTCAGGGCCAC
CCAGTGCTCCTGCAGAAGATCGTTCAGGAACACCCGACAGCATTGCTTCCTCCTCCTCAG
CAGCTCACCCACCAGGCGTTCAGCCACAGCAGCCACCATATACAGGAGCTCAGACTCAAG
CAGGTCAGATTGAAGGTCAGATGTACCAACAGTACCAGCAACAGGCCGGCTATGGTGCAC
AGCAGCCGCAGGCTCCACCTCAGCAGCCTCAACAGTATGGTATTCAGTATTCAGCAAGCT
ATAGTCAGCAGACTGGACCTCAACAACCTCAGCAGTTCCAGGGATATGGCCAGCAACCAA
CTTCCCAGGCACCAGCTCCTGCCTTTTCTGGTCAGCCTCAACAACTGCCTGCTCAGCCGC
CACAGCAGTACCAGGCGAGCAATTATCCTGCACAAACTTACACTGCCCAAACTTCTCAGC
CTACTAATTATACTGTGGCTCCTGCCTCTCAACCTGGAATGGCTCCAAGCCAACCTGGGG
CCTATCAACCAAGACCAGGTTTTACTTCACTTCCTGGAAGTACCATGACCCCTCCTCCAA
GTGGGCCTAATCCTTATGCGCGTAACCGTCCTCCCTTTGGTCAGGGCTATACCCAACCTG
GACCTGGTTATCGATAAGGAGGCTCCTCTACACCAATTAATGTAGCTGCTAGCTATTGGC
CTCCCAAAAGACTCCAGTACTATTTTAATTTGTATTGAAGAAGTTCAGAAATTTAAAAGC
AGAGCATTTTTTATGATATCATTGTTGGTGTTAATTGAAAGTATAATTTGCTGGAACACA
AAGACCAAAATGAAAGTTTTTTCCTCCCTGCTTAAAAATGTAGCAGCTTCTTAGTTACTT
TGGAACACTACTCTTACATGTATAAAGTGATTGACTTGACTTTCTAGCTTCCCTTGTCCG
GAGGATATTAAAATGCTAGGGTGAGGTTTAGCCATCTTACTTGGCTTTTTACTATTAACA
TGATGTACTAAAGTAGAGCCCTTTGAGAATACAAGATATTATGTATAAAATGTAACACTG
ATGATAGGTTAATAAAGATGATTGAATCCATTAAAAAAAAAAAAAAAAAA

Protein Sequence

>10342 : length: 400
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKN
VMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIE
GQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAP
APAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPR
PGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR