ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1033

Name

CDKN3

Synonym

CDI1|CIP2|KAP|KAP1;cyclin-dependent kinase inhibitor 3;CDKN3;cyclin-dependent kinase inhibitor 3

Definition

CDK2-associated dual specificity phosphatase|CDK2-associated dual-specificity phosphatase|Cdk-associated protein phosphatase|cyclin-dependent kinase interacting protein 2|cyclin-dependent kinase interactor 1|cyclin-dependent kinase-interacting protein 2|k

Position

14q22

Gene Type

protein-coding

External Links

Links to cell senescence gene database

1033

Links to epithelial mesenchymal transition gene database

1033

Links to ovarian cancer gene database

1033

Links to endometrial cancer gene database

1033

Links to iHOP

1033

Sequence Information

Nucleotide Sequence

>1033 : length: 906
ACAGAAGGACGAACCAGTGAGCTAAGCTGCGGGGCGCGGGCTCGGCCGGGGCACCGGTGA
GTCGCCGGCGCTGCAGAGGGAGGCGGCACTGGTCTCGACGTGGGGCGGCCAGCGATGAAG
CCGCCCAGTTCAATACAAACAAGTGAGTTTGACTCATCAGATGAAGAGCCTATTGAAGAT
GAACAGACTCCAATTCATATATCATGGCTATCTTTGTCACGAGTGAATTGTTCTCAGTTT
CTCGGTTTATGTGCTCTTCCAGGTTGTAAATTTAAAGATGTTAGAAGAAATGTCCAAAAA
GATACAGAAGAACTAAAGAGCTGTGGTATACAAGACATATTTGTTTTCTGCACCAGAGGG
GAACTGTCAAAATATAGAGTCCCAAACCTTCTGGATCTCTACCAGCAATGTGGAATTATC
ACCCATCATCATCCAATCGCAGATGGAGGGACTCCTGACATAGCCAGCTGCTGTGAAATA
ATGGAAGAGCTTACAACCTGCCTTAAAAATTACCGAAAAACCTTAATACACTGCTATGGA
GGACTTGGGAGATCTTGTCTTGTAGCTGCTTGTCTCCTACTATACCTGTCTGACACAATA
TCACCAGAGCAAGCCATAGACAGCCTGCGAGACCTAAGAGGATCCGGGGCAATACAGACC
ATCAAGCAATACAATTATCTTCATGAGTTTCGGGACAAATTAGCTGCACATCTATCATCA
AGAGATTCACAATCAAGATCTGTATCAAGATAAAGGAATTCAAATAGCATATATATGACC
ATGTCTGAAATGTCAGTTCTCTAGCATAATTTGTATTGAAATGAAACCACCAGTGTTATC
AACTTGAATGTAAATGTACATGTGCAGATATTCCTAAAGTTTTATTGACAAAAAAAAAAA
AAAAAA

Protein Sequence

>1033 : length: 212
MKPPSSIQTSEFDSSDEEPIEDEQTPIHISWLSLSRVNCSQFLGLCALPGCKFKDVRRNV
QKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCGIITHHHPIADGGTPDIASCC
EIMEELTTCLKNYRKTLIHCYGGLGRSCLVAACLLLYLSDTISPEQAIDSLRDLRGSGAI
QTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR