ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10320

Name

IKZF1

Synonym

Hs.54452|IK1|IKAROS|LYF1|LyF-1|PPP1R92|PRO0758|ZNFN1A1;IKAROS family zinc finger 1 (Ikaros);IKZF1;IKAROS family zinc finger 1 (Ikaros)

Definition

CLL-associated antigen KW-6|DNA-binding protein Ikaros|ikaros family zinc finger protein 1|lymphoid transcription factor LyF-1|protein phosphatase 1, regulatory subunit 92|zinc finger protein, subfamily 1A, 1 (Ikaros)

Position

7p12.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Disease

Leukemia, acute lymphoblastic;OMIM

Disease

hippocampal atrophy;GAD

Disease

Bone marrow disease;FunDO

Disease

Hippocampal atrophy;NHGRI

Disease

Mean corpuscular volume;NHGRI

Disease

HEMATOLOGICAL;GAD

Disease

Acute lymphoblastic leukemia (childhood);NHGRI

Disease

Acute lymphoblastic leukemia (childhood);GAD

Disease

IMMUNE;GAD

Disease

Lymphoma;FunDO

Disease

Leukemia;FunDO

Disease

CANCER;GAD

Disease

Lymphoproliferative disorder;FunDO

Disease

Systemic lupus erythematosus;NHGRI

Disease

Hematopoietic system disease;FunDO

Disease

systemic lupus erythematosus;GAD

Disease

mean corpuscular volume;GAD

Disease

NEUROLOGICAL;GAD

External Links

Links to cell senescence gene database

10320

Links to epithelial mesenchymal transition gene database

10320

Links to ovarian cancer gene database

10320

Links to endometrial cancer gene database

10320

Links to iHOP

10320

Sequence Information

Nucleotide Sequence

>10320 : length: 6459
CGCGGGGCAGCCGGTCGGCCGGGAGCGCGAAAGCCTGGTCTGAGCCGGCTGGGGGCGGGG
AGTGTGGCGGAGAAATGGGGAACAATGCGAGTGAGCAACTTCAGGAAGTCATTGTGAAAG
AAAGCTGGGAAGAGCTCCGCGGCCAAGTTAGCAGGACACTCTAACAAGTGACTGCGCGGC
CCGCGCCCGGGGCGGTGACTGCGGCAAGCCCCCTGGGTCCCCGCGCGGCGCATCCCAGCC
TGGGCGGGACGCTCGGCCGCGGCGAGGCGGGCAAGCCTGGCAGGGCAGAGGGAGCCCCGG
CTCCGAGGTTGCTCTTCGCACCCGAGGATCAGTCTTGGCCCCAAAGCGCGACGCACAAAT
CCACATAACCTGAGGACCATGGATGCTGATGAGGGTCAAGACATGTCCCAAGTTTCAGGG
AAGGAAAGCCCCCCTGTAAGCGATACTCCAGATGAGGGCGATGAGCCCATGCCGATCCCC
GAGGACCTCTCCACCACCTCGGGAGGACAGCAAAGCTCCAAGAGTGACAGAGTCGTGGTT
ACATATGGGGCTGATGACTTTAGGGATTTCCATGCAATAATTCCCAAATCTTTCTCTCCC
AGTAATGTTAAAGTAGAGACTCAGAGTGATGAAGAGAATGGGCGTGCCTGTGAAATGAAT
GGGGAAGAATGTGCGGAGGATTTACGAATGCTTGATGCCTCGGGAGAGAAAATGAATGGC
TCCCACAGGGACCAAGGCAGCTCGGCTTTGTCGGGAGTTGGAGGCATTCGACTTCCTAAC
GGAAAACTAAAGTGTGATATCTGTGGGATCATTTGCATCGGGCCCAATGTGCTCATGGTT
CACAAAAGAAGCCACACTGGAGAACGGCCCTTCCAGTGCAATCAGTGCGGGGCCTCATTC
ACCCAGAAGGGCAACCTGCTCCGGCACATCAAGCTGCATTCCGGGGAGAAGCCCTTCAAA
TGCCACCTCTGCAACTACGCCTGCCGCCGGAGGGACGCCCTCACTGGCCACCTGAGGACG
CACTCCGTTGGTAAACCTCACAAATGTGGATATTGTGGCCGAAGCTATAAACAGCGAAGC
TCTTTAGAGGAACATAAAGAGCGCTGCCACAACTACTTGGAAAGCATGGGCCTTCCGGGC
ACACTGTACCCAGTCATTAAAGAAGAAACTAATCACAGTGAAATGGCAGAAGACCTGTGC
AAGATAGGATCAGAGAGATCTCTCGTGCTGGACAGACTAGCAAGTAACGTCGCCAAACGT
AAGAGCTCTATGCCTCAGAAATTTCTTGGGGACAAGGGCCTGTCCGACACGCCCTACGAC
AGCAGCGCCAGCTACGAGAAGGAGAACGAAATGATGAAGTCCCACGTGATGGACCAAGCC
ATCAACAACGCCATCAACTACCTGGGGGCCGAGTCCCTGCGCCCGCTGGTGCAGACGCCC
CCGGGCGGTTCCGAGGTGGTCCCGGTCATCAGCCCGATGTACCAGCTGCACAAGCCGCTC
GCGGAGGGCACCCCGCGCTCCAACCACTCGGCCCAGGACAGCGCCGTGGAGAACCTGCTG
CTGCTCTCCAAGGCCAAGTTGGTGCCCTCGGAGCGCGAGGCGTCCCCGAGCAACAGCTGC
CAAGACTCCACGGACACCGAGAGCAACAACGAGGAGCAGCGCAGCGGTCTCATCTACCTG
ACCAACCACATCGCCCCGCACGCGCGCAACGGGCTGTCGCTCAAGGAGGAGCACCGCGCC
TACGACCTGCTGCGCGCCGCCTCCGAGAACTCGCAGGACGCGCTCCGCGTGGTCAGCACC
AGCGGGGAGCAGATGAAGGTGTACAAGTGCGAACACTGCCGGGTGCTCTTCCTGGATCAC
GTCATGTACACCATCCACATGGGCTGCCACGGCTTCCGTGATCCTTTTGAGTGCAACATG
TGCGGCTACCACAGCCAGGACCGGTACGAGTTCTCGTCGCACATAACGCGAGGGGAGCAC
CGCTTCCACATGAGCTAAAGCCCTCCCGCGCCCCCACCCCAGACCCCGAGCCACCCCAGG
AAAAGCACAAGGACTGCCGCCTTCTCGCTCCCGCCAGCAGCATAGACTGGACTGGACCAG
ACAATGTTGTGTTTGGATTTGTAACTGTTTTTTGTTTTTTGTTTGAGTTGGTTGATTGGG
GTTTGATTTGCTTTTGAAAAGATTTTTATTTTTAGAGGCAGGGCTGCATTGGGAGCATCC
AGAACTGCTACCTTCCTAGATGTTTCCCCAGACCGCTGGCTGAGATTCCCTCACCTGTCG
CTTCCTAGAATCCCCTTCTCCAAACGATTAGTCTAAATTTTCAGAGAGAAATAGATAAAA
CACGCCACAGCCTGGGAAGGAGCGTGCTCTACCCTGTGCTAAGCACGGGGTTCGCGCACC
AGGTGTCTTTTTCCAGTCCCCAGAAGCAGAGAGCACAGCCCCTGCTGTGTGGGTCTGCAG
GTGAGCAGACAGGACAGGTGTGCCGCCACCCAAGTGCCAAGACACAGCAGGGCCAACAAC
CTGTGCCCAGGCCAGCTTCGAGCTACATGCATCTAGGGCGGAGAGGCTGCACTTGTGAGA
GAAAATACTATTTCAAGTCATATTCTGCGTAGGAAAATGAATTGGTTGGGGAAAGTCGTG
TCTGTCAGACTGCCCTGGGTGGAGGGAGACGCCGGGCTAGAGCCTTTGGGATCGTCCTGG
ATTCACTGGCTTTGCGGAGGCTGCTCAGATGGCCTGAGCCTCCCGAGGCTTGCTGCCCCG
TAGGAGGAGACTGTCTTCCCGTGGGCATATCTGGGGAGCCCTGTTCCCCGCTTTTTCACT
CCCATACCTTTAATGGCCCCCAAAATCTGTCACTACAATTTAAACACCAGTCCCGAAATT
TGGATCTTCTTTCTTTTTGAATCTCTCAAACGGCAACATTCCTCAGAAACCAAAGCTTTA
TTTCAAATCTCTTCCTTCCCTGGCTGGTTCCATCTAGTACCAGAGGCCTCTTTTCCTGAA
GAAATCCAATCCTAGCCCTCATTTTAATTATGTACATCTGTTTGTAGCCACAAGCCTGAA
TTTCTCAGTGTTGGTAAGTTTCTTTACCTACCCTCACTATATATTATTCTCGTTTTAAAA
CCCATAAAGGAGTGATTTAGAACAGTCATTAATTTTCAACTCAATGAAATATGTGAAGCC
CAGCATCTCTGTTGCTAACACACAGAGCTCACCTGTTTGAAACCAAGCTTTCAAACATGT
TGAAGCTCTTTACTGTAAAGGCAAGCCAGCATGTGTGTCCACACATACATAGGATGGCTG
GCTCTGCACCTGTAGGATATTGGAATGCACAGGGCAATTGAGGGACTGAGCCAGACCTTC
GGAGAGTAATGCCACCAGATCCCCTAGGAAAGAGGAGGCAAATGGCACTGCAGGTGAGAA
CCCCGCCCATCCGTGCTATGACATGGAGGCACTGAAGCCCGAGGAAGGTGTGTGGAGATT
CTAATCCCAACAAGCAAGGGTCTCCTTCAAGATTAATGCTATCAATCATTAAGGTCATTA
CTCTCAACCACCTAGGCAATGAAGAATATACCATTTCAAATATTTACAGTACTTGTCTTC
ACCAACACTGTCCCAAGGTGAAATGAAGCAACAGAGAGGAAATTGTACATAAGTACCTCA
GCATTTAATCCAAACAGGGGTTCTTAGTCTCAGCACTATGACATTTTGGGCTGACTACTT
ATTTGTTAGGCGGGAGCTCTCCTGTGCATTGTAGGATAATTAGCAGTATCCCTGGTGGCT
ACCCAATAGACGCCAGTAGCACCCCGAATTGACAACCCAAACTCTCCAGACATCACCAAC
TGTCCCCTGCGAGGAGAAATCACTCCTGGGGGAGAACCACTGACCCAAATGAATTCTAAA
CCAATCAAATGTCTGGGAAGCCCTCCAAGAAAAAAAATAGAAAAGCACTTGAAGAATATT
CCCAATATTCCCGGTCAGCAGTATCAAGGCTGACTTGTGTTCATGTGGAGTCATTATAAA
TTCTATAAATCAATTATTCCCCTTCGGTCTTAAAAATATATTTCCTCATAAACATTTGAG
TTTTGTTGAAAAGATGGAGTTTACAAAGATACCATTCTTGAGTCATGGATTTCTCTGCTC
ACAGAAGGGTGTGGCATTTGGAAACGGGAATAAACAAAATTGCTGCACCAATGCACTGAG
TGAAGGAAGAGAGACAGAGGATCAAGGGCTTTAGACAGCACTCCTTCAATATGCAATCAC
AGAGAAAGATGCGCCTTATCCAAGTTAATATCTCTAAGGTGAGAGCCTTCTTAGAGTCAG
TTTGTTGCAAATTTCACCTACTCTGTTCTTTTCCATCCATCCCCCTGAGTCAGTTGGTTG
AAGGGAGTTATTTTTTCAAGTGGAATTCAAACAAAGCTCAAACCAGAACTGTAAATAGTG
ATTGCAGGAATTCTTTTCTAAACTGCTTTGCCCTTTCCTCTCACTGCCTTTTATAGCCAA
TATAAATGTCTCTTTGCACACCTTTTGTTGTGGTTTTATATTGTAACACCATTTTTCTTT
GAAACTATTGTATTTAAAGTAAGGTTTCATATTATGTCAGCAAGTAATTAACTTATGTTT
AAAAGGTGGCCATATCATGTACCAAAAGTTGCTGAAGTTTCTCTTCTAGCTGGTAAAGTA
GGAGTTTGCATGACTTCACACTTTTTTTGCGTAGTTTCTTCTGTTGTATGATGGCGTGAG
TGTGTGTCTTGGGTACCGCTGTGTACTACTGTGTGCCTAGATTCCATGCACTCTCGTTGT
GTTTGAAGTAAATATTGGAGACCGGAGGGTAACAGGTTGGCCTGTTGATTACAGCTAGTA
ATCGCTGTGTCTTGTTCCGCCCCCTCCCTGACACCCCAGCTTCCCAGGATGTGGAAAGCC
TGGATCTCAGCTCCTTGCCCCATATCCCTTCTGTAATTTGTACCTAAAGAGTGTGATTAT
CCTAATTCAAGAGTCACTAAAACTCATCACATTATCATTGCATATCAGCAAAGGGTAAAG
TCCTAGCACCAATTGCTTCACATACCAGCATGTTCCATTTCCAATTTAGAATTAGCCACA
TAATAAAATCTTAGAATCTTCCTTGAGAAAGAGCTGCCTGAGATGTAGTTTTGTTATATG
GTTCCCCACCGACCATTTTTGTGCTTTTTTCTTGTTTTGTTTTGTTTTGACTGCACTGTG
AGTTTTGTAGTGTCCTCTTCTTGCCAAAACAAACGCGAGATGAACTGGACTTATGTAGAC
AAATCGTGATGCCAGTGTATCCTTCCTTTCTTCAGTTCCAGCAATAATGAATGGTCAACT
TTTTTAAAATCTAGATCTCTCTCATTCATTTCAATGTATTTTTACTTTAAGATGAACCAA
AATTATTAGACTTATTTAAGATGTACAGGCATCAGAAAAAAGAAGCACATAATGCTTTTG
GTGCGATGGCACTCACTGTGAACATGTGTAACCACATATTAATATGCAATATTGTTTCCA
ATACTTTCTAATACAGTTTTTTATAATGTTGTGTGTGGTGATTGTTCAGGTCGAATCTGT
TGTATCCAGTACAGCTTTAGGTCTTCAGCTGCCCTTCTGGCGAGTACATGCACAGGATTG
TAAATGAGAAATGCAGTCATATTTCCAGTCTGCCTCTATGATGATGTTAAATTATTGCTG
TTTAGCTGTGAACAAGGGATGTACCACTGGAGGAATAGAGTATCCTTTTGTACACATTTT
GAAATGCTTCTTCTGTAGTGATAGAACAAATAAATGCAACGAATACTCTGTCTGCCCTAT
CCCGTGAAGTCCACACTGGCGTAAGAGAAGGCCCAGCAGAGCAGGAATCTGCCTAGACTT
TCTCCCAATGAGATCCCAATATGAGAGGGAGAAGAGATGGGCCTCAGGACAGCTGCAATA
CCACTTGGGAACACATGTGGTGTCTTGATGTGGCCAGCGCAGCAGTTCAGCACAACGTAC
CTCCCATCTACAACAGTGCTGGACGTGGGAATTCTAAGTCCCAGTCTTGAGGGTGGGTGG
AGATGGAGGGCAACAAGAGATACATTTCCAGTTCTCCACTGCAGCATGCTTCAGTCATTC
TGTGAGTGGCCGGGCCCAGGGCCCTCACAATTTCACTACCTTGTCTTTTACATAGTCATA
AGAATTATCCTCAACATAGCCTTTTGACGCTGTAAATCTTGAGTATTCATTTACCCTTTT
CTGATCTCCTGGAAACAGCTGCCTGCCTGCATTGCACTTCTCTTCCCGAGGAGTGGGGTA
AATTTAAAAGTCAAGTTATAGTTTGGATGTTAGTATAGAATTTTGAAATTGGGAATTAAA
AATCAGGACTGGGGACTGGGAGACCAAAAATTTCTGATCCCATTTCTGATGGATGTGTCA
CACCTTTTCTGTCAAAATAAAATGTCTTGGAGGTTATGA

Protein Sequence

>10320 : length: 563
MEGAILTSAVSRWEGRETRDNLRTMDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPED
LSTTSGGQQSSKSDRVVVTYGADDFRDFHAIIPKSFSPSNVKVETQSDEENGRACEMNGE
ECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHK
RSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHS
VGKPHKCGYCGRSYKQRSSLEEHKERCHNYLESMGLPGTLYPVIKEETNHSEMAEDLCKI
GSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAIN
NAINYLGAESLRPLVQTPPGGSEVVPVISPMYQLHKPLAEGTPRSNHSAQDSAVENLLLL
SKAKLVPSEREASPSNSCQDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYD
LLRAASENSQDALRVVSTSGEQMKVYKCEHCRVLFLDHVMYTIHMGCHGFRDPFECNMCG
YHSQDRYEFSSHITRGEHRFHMS