ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1027

Name

CDKN1B

Synonym

CDKN4|KIP1|MEN1B|MEN4|P27KIP1;cyclin-dependent kinase inhibitor 1B (p27, Kip1);CDKN1B;cyclin-dependent kinase inhibitor 1B (p27, Kip1)

Definition

cyclin-dependent kinase inhibitor 1B

Position

12p13.1-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

DNA Replication;Reactome;REACT:383

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

cdk regulation of dna replication;PID BioCarta;100110

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Regulation of RhoA activity;PID Curated;200050

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

Cyclin E associated events during G1/S transition;PID Reactome;500877

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

FoxO family signaling;PID Curated;200091

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

regulation of p27 phosphorylation during cell cycle progression;PID BioCarta;100087

Disease

Coronary Restenosis;GAD

Disease

overall effect;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Ulcerative colitis;FunDO

Disease

endometriosis;GAD

Disease

prostate cancer;GAD

Disease

head and neck cancer;GAD

Disease

Coronary Artery Disease;GAD

Disease

Hyperparathyroidism;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Proteinuria;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Multiple endocrine neoplasia;FunDO

Disease

CANCER;GAD

Disease

Adenovirus infection;FunDO

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Multiple endocrine neoplasia, type IV;OMIM

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

breast cancer;GAD

Disease

Testicular dysfunction;FunDO

Disease

Prostate cancer;KEGG DISEASE;H00024

Disease

ovarian cancer;GAD

Disease

myocardial infarct;GAD

External Links

Links to cell senescence gene database

1027

Links to epithelial mesenchymal transition gene database

1027

Links to ovarian cancer gene database

1027

Links to endometrial cancer gene database

1027

Links to iHOP

1027

Sequence Information

Nucleotide Sequence

>1027 : length: 2535
TTAAGGCCGCGCTCGCCAGCCTCGGCGGGGCGGCTCCCGCCGCCGCAACCAATGGATCTC
CTCCTCTGTTTAAATAGACTCGCCGTGTCAATCATTTTCTTCTTCGTCAGCCTCCCTTCC
ACCGCCATATTGGGCCACTAAAAAAAGGGGGCTCGTCTTTTCGGGGTGTTTTTCTCCCCC
TCCCCTGTCCCCGCTTGCTCACGGCTCTGCGACTCCGACGCCGGCAAGGTTTGGAGAGCG
GCTGGGTTCGCGGGACCCGCGGGCTTGCACCCGCCCAGACTCGGACGGGCTTTGCCACCC
TCTCCGCTTGCCTGGTCCCCTCTCCTCTCCGCCCTCCCGCTCGCCAGTCCATTTGATCAG
CGGAGACTCGGCGGCCGGGCCGGGGCTTCCCCGCAGCCCCTGCGCGCTCCTAGAGCTCGG
GCCGTGGCTCGTCGGGGTCTGTGTCTTTTGGCTCCGAGGGCAGTCGCTGGGCTTCCGAGA
GGGGTTCGGGCTGCGTAGGGGCGCTTTGTTTTGTTCGGTTTTGTTTTTTTGAGAGTGCGA
GAGAGGCGGTCGTGCAGACCCGGGAGAAAGATGTCAAACGTGCGAGTGTCTAACGGGAGC
CCTAGCCTGGAGCGGATGGACGCCAGGCAGGCGGAGCACCCCAAGCCCTCGGCCTGCAGG
AACCTCTTCGGCCCGGTGGACCACGAAGAGTTAACCCGGGACTTGGAGAAGCACTGCAGA
GACATGGAAGAGGCGAGCCAGCGCAAGTGGAATTTCGATTTTCAGAATCACAAACCCCTA
GAGGGCAAGTACGAGTGGCAAGAGGTGGAGAAGGGCAGCTTGCCCGAGTTCTACTACAGA
CCCCCGCGGCCCCCCAAAGGTGCCTGCAAGGTGCCGGCGCAGGAGAGCCAGGATGTCAGC
GGGAGCCGCCCGGCGGCGCCTTTAATTGGGGCTCCGGCTAACTCTGAGGACACGCATTTG
GTGGACCCAAAGACTGATCCGTCGGACAGCCAGACGGGGTTAGCGGAGCAATGCGCAGGA
ATAAGGAAGCGACCTGCAACCGACGATTCTTCTACTCAAAACAAAAGAGCCAACAGAACA
GAAGAAAATGTTTCAGACGGTTCCCCAAATGCCGGTTCTGTGGAGCAGACGCCCAAGAAG
CCTGGCCTCAGAAGACGTCAAACGTAAACAGCTCGAATTAAGAATATGTTTCCTTGTTTA
TCAGATACATCACTGCTTGATGAAGCAAGGAAGATATACATGAAAATTTTAAAAATACAT
ATCGCTGACTTCATGGAATGGACATCCTGTATAAGCACTGAAAAACAACAACACAATAAC
ACTAAAATTTTAGGCACTCTTAAATGATCTGCCTCTAAAAGCGTTGGATGTAGCATTATG
CAATTAGGTTTTTCCTTATTTGCTTCATTGTACTACCTGTGTATATAGTTTTTACCTTTT
ATGTAGCACATAAACTTTGGGGAAGGGAGGGCAGGGTGGGGCTGAGGAACTGACGTGGAG
CGGGGTATGAAGAGCTTGCTTTGATTTACAGCAAGTAGATAAATATTTGACTTGCATGAA
GAGAAGCAATTTTGGGGAAGGGTTTGAATTGTTTTCTTTAAAGATGTAATGTCCCTTTCA
GAGACAGCTGATACTTCATTTAAAAAAATCACAAAAATTTGAACACTGGCTAAAGATAAT
TGCTATTTATTTTTACAAGAAGTTTATTCTCATTTGGGAGATCTGGTGATCTCCCAAGCT
ATCTAAAGTTTGTTAGATAGCTGCATGTGGCTTTTTTAAAAAAGCAACAGAAACCTATCC
TCACTGCCCTCCCCAGTCTCTCTTAAAGTTGGAATTTACCAGTTAATTACTCAGCAGAAT
GGTGATCACTCCAGGTAGTTTGGGGCAAAAATCCGAGGTGCTTGGGAGTTTTGAATGTTA
AGAATTGACCATCTGCTTTTATTAAATTTGTTGACAAAATTTTCTCATTTTCTTTTCACT
TCGGGCTGTGTAAACACAGTCAAAATAATTCTAAATCCCTCGATATTTTTAAAGATCTGT
AAGTAACTTCACATTAAAAAATGAAATATTTTTTAATTTAAAGCTTACTCTGTCCATTTA
TCCACAGGAAAGTGTTATTTTTCAAGGAAGGTTCATGTAGAGAAAAGCACACTTGTAGGA
TAAGTGAAATGGATACTACATCTTTAAACAGTATTTCATTGCCTGTGTATGGAAAAACCA
TTTGAAGTGTACCTGTGTACATAACTCTGTAAAAACACTGAAAAATTATACTAACTTATT
TATGTTAAAAGATTTTTTTTAATCTAGACAATATACAAGCCAAAGTGGCATGTTTTGTGC
ATTTGTAAATGCTGTGTTGGGTAGAATAGGTTTTCCCCTCTTTTGTTAAATAATATGGCT
ATGCTTAAAAGGTTGCATACTGAGCCAAGTATAATTTTTTGTAATGTGTGAAAAAGATGC
CAATTATTGTTACACATTAAGTAATCAATAAAGAAAACTTCCATAGCTATTCATTGAGTC
AAAAAAAAAAAAAAA

Protein Sequence

>1027 : length: 198
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT