ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1026

Name

CDKN1A

Synonym

CAP20|CDKN1|CIP1|MDA-6|P21|SDI1|WAF1|p21CIP1;cyclin-dependent kinase inhibitor 1A (p21, Cip1);CDKN1A;cyclin-dependent kinase inhibitor 1A (p21, Cip1)

Definition

CDK-interacting protein 1|CDK-interaction protein 1|DNA synthesis inhibitor|cyclin-dependent kinase inhibitor 1|melanoma differentiation associated protein 6|wild-type p53-activated fragment 1

Position

6p21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

effects of calcineurin in keratinocyte differentiation;PID BioCarta;100222

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

cell cycle: g2/m checkpoint;PID BioCarta;100159

Pathway

Transcriptional activation of cell cycle inhibitor p21;PID Reactome;501023

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Cyclin A:Cdk2-associated events at S phase entry;PID Reactome;500375

Pathway

Hepatitis C;KEGG PATHWAY;hsa05160

Pathway

Signalling by NGF;Reactome;REACT:11061

Pathway

rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

p53 pathway;PANTHER;P00059

Pathway

Signaling events mediated by HDAC Class III;PID Curated;200020

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

Cyclin E associated events during G1/S transition;PID Reactome;500877

Pathway

ErbB signaling pathway;KEGG PATHWAY;hsa04012

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

erythropoietin mediated neuroprotection through nf-kb;PID BioCarta;100176

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

Cell Cycle Checkpoints;Reactome;REACT:1538

Pathway

p53 pathway feedback loops 2;PANTHER;P04398

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

DNA Replication;Reactome;REACT:383

Disease

overall effect;GAD

Disease

Hemolytic-Uremic syndrome;FunDO

Disease

bladder cancer;GAD

Disease

Cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

Lupus Nephritis;GAD

Disease

Neck cancer;FunDO

Disease

Keratosis;FunDO

Disease

oral cancer;GAD

Disease

Dermatitis;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

IMMUNE;GAD

Disease

Infection;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

prostate cancer;GAD

Disease

head and neck cancer;GAD

Disease

Lupus Erythematosus, Systemic;GAD

Disease

Sarcoidosis;FunDO

Disease

Hyperparathyroidism;FunDO

Disease

CANCER;GAD

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Endometriosis;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Chronic simple glaucoma;FunDO

Disease

Electrocardiographic traits;NHGRI

Disease

Papillomavirus infection;FunDO

Disease

Cervical cancer;KEGG DISEASE;H00030

Disease

breast cancer;GAD

Disease

Metaplastic polyp;FunDO

Disease

stomach cancer;GAD

External Links

Links to cell senescence gene database

1026

Links to epithelial mesenchymal transition gene database

1026

Links to ovarian cancer gene database

1026

Links to endometrial cancer gene database

1026

Links to iHOP

1026

Sequence Information

Nucleotide Sequence

>1026 : length: 2325
ATGGTAGGAGACAGGAGACCTCTAAAGACCCCAGAAATAAAGGATGACAAGCAGAGAGCC
CCGGGCAGGAGGCAAAAGTCCTGTGTTCCAACTATAGTCATTTCTTTGCTGCATGATCTG
AGTTAGGTCACCAGACTTCTCTGAGCCCCAGTTTCCCCAGCAGTGTATACGGGCTATGTG
GGGAGTATTCAGGAGACAGACAACTCACTCGTCAAATCCTCCCCTTCCTGGCCAACAAAG
CTGCTGCAACCACAGGGATTTCTTCTGTTCAGGCGCCATGTCAGAACCGGCTGGGGATGT
CCGTCAGAACCCATGCGGCAGCAAGGCCTGCCGCCGCCTCTTCGGCCCAGTGGACAGCGA
GCAGCTGAGCCGCGACTGTGATGCGCTAATGGCGGGCTGCATCCAGGAGGCCCGTGAGCG
ATGGAACTTCGACTTTGTCACCGAGACACCACTGGAGGGTGACTTCGCCTGGGAGCGTGT
GCGGGGCCTTGGCCTGCCCAAGCTCTACCTTCCCACGGGGCCCCGGCGAGGCCGGGATGA
GTTGGGAGGAGGCAGGCGGCCTGGCACCTCACCTGCTCTGCTGCAGGGGACAGCAGAGGA
AGACCATGTGGACCTGTCACTGTCTTGTACCCTTGTGCCTCGCTCAGGGGAGCAGGCTGA
AGGGTCCCCAGGTGGACCTGGAGACTCTCAGGGTCGAAAACGGCGGCAGACCAGCATGAC
AGATTTCTACCACTCCAAACGCCGGCTGATCTTCTCCAAGAGGAAGCCCTAATCCGCCCA
CAGGAAGCCTGCAGTCCTGGAAGCGCGAGGGCCTCAAAGGCCCGCTCTACATCTTCTGCC
TTAGTCTCAGTTTGTGTGTCTTAATTATTATTTGTGTTTTAATTTAAACACCTCCTCATG
TACATACCCTGGCCGCCCCCTGCCCCCCAGCCTCTGGCATTAGAATTATTTAAACAAAAA
CTAGGCGGTTGAATGAGAGGTTCCTAAGAGTGCTGGGCATTTTTATTTTATGAAATACTA
TTTAAAGCCTCCTCATCCCGTGTTCTCCTTTTCCTCTCTCCCGGAGGTTGGGTGGGCCGG
CTTCATGCCAGCTACTTCCTCCTCCCCACTTGTCCGCTGGGTGGTACCCTCTGGAGGGGT
GTGGCTCCTTCCCATCGCTGTCACAGGCGGTTATGAAATTCACCCCCTTTCCTGGACACT
CAGACCTGAATTCTTTTTCATTTGAGAAGTAAACAGATGGCACTTTGAAGGGGCCTCACC
GAGTGGGGGCATCATCAAAAACTTTGGAGTCCCCTCACCTCCTCTAAGGTTGGGCAGGGT
GACCCTGAAGTGAGCACAGCCTAGGGCTGAGCTGGGGACCTGGTACCCTCCTGGCTCTTG
ATACCCCCCTCTGTCTTGTGAAGGCAGGGGGAAGGTGGGGTCCTGGAGCAGACCACCCCG
CCTGCCCTCATGGCCCCTCTGACCTGCACTGGGGAGCCCGTCTCAGTGTTGAGCCTTTTC
CCTCTTTGGCTCCCCTGTACCTTTTGAGGAGCCCCAGCTACCCTTCTTCTCCAGCTGGGC
TCTGCAATTCCCCTCTGCTGCTGTCCCTCCCCCTTGTCCTTTCCCTTCAGTACCCTCTCA
GCTCCAGGTGGCTCTGAGGTGCCTGTCCCACCCCCACCCCCAGCTCAATGGACTGGAAGG
GGAAGGGACACACAAGAAGAAGGGCACCCTAGTTCTACCTCAGGCAGCTCAAGCAGCGAC
CGCCCCCTCCTCTAGCTGTGGGGGTGAGGGTCCCATGTGGTGGCACAGGCCCCCTTGAGT
GGGGTTATCTCTGTGTTAGGGGTATATGATGGGGGAGTAGATCTTTCTAGGAGGGAGACA
CTGGCCCCTCAAATCGTCCAGCGACCTTCCTCATCCACCCCATCCCTCCCCAGTTCATTG
CACTTTGATTAGCAGCGGAACAAGGAGTCAGACATTTTAAGATGGTGGCAGTAGAGGCTA
TGGACAGGGCATGCCACGTGGGCTCATATGGGGCTGGGAGTAGTTGTCTTTCCTGGCACT
AACGTTGAGCCCCTGGAGGCACTGAAGTGCTTAGTGTACTTGGAGTATTGGGGTCTGACC
CCAAACACCTTCCAGCTCCTGTAACATACTGGCCTGGACTGTTTTCTCTCGGCTCCCCAT
GTGTCCTGGTTCCCGTTTCTCCACCTAGACTGTAAACCTCTCGAGGGCAGGGACCACACC
CTGTACTGTTCTGTGTCTTTCACAGCTCCTCCCACAATGCTGAATATACAGCAGGTGCTC
AATAAATGATTCTTAGTGACTTTACTTGTAAAAAAAAAAAAAAAA

Protein Sequence

>1026 : length: 198
MWGVFRRQTTHSSNPPLPGQQSCCNHRDFFCSGAMSEPAGDVRQNPCGSKACRRLFGPVD
SEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGR
DELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTS
MTDFYHSKRRLIFSKRKP