ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10253

Name

SPRY2

Synonym

hSPRY2;sprouty homolog 2 (Drosophila);SPRY2;sprouty homolog 2 (Drosophila)

Definition

protein sprouty homolog 2|sprouty 2|spry-2

Position

13q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

Signaling by EGFR;Reactome;REACT:9417

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Internalization of ErbB1;PID Curated;200146

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

EGFR downregulation;PID Reactome;500515

Pathway

sprouty regulation of tyrosine kinase signals;PID BioCarta;100029

Pathway

FGF signaling pathway;PANTHER;P00021

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Type 2 diabetes;NHGRI

Disease

Prostate cancer;FunDO

Disease

nonsyndromic cleft lip with or without cleft palate;GAD

Disease

Nonsyndromic cleft lip with or without cleft palate;NHGRI

Disease

Melanoma;FunDO

Disease

Liver cancer;FunDO

Disease

DEVELOPMENTAL;GAD

External Links

Links to cell senescence gene database

10253

Links to epithelial mesenchymal transition gene database

10253

Links to ovarian cancer gene database

10253

Links to endometrial cancer gene database

10253

Links to iHOP

10253

Sequence Information

Nucleotide Sequence

>10253 : length: 2666
AGCTTTGAAGAAGGAGGCCAGGGATCGGATCGGCAGAAATCACTTAAAAAATAAAAACAA
AAAAGCCCCCTTTTATTTCAAAGATGCTACTTTGACTGCAAGCAAATCTGCACCGAAAGT
TTACAGCTCCGGGAGCTGGGTCCTGCGCGCCCGGAGTGAGCAGTGGGACCCTGGAAAATG
CCCTTTTTTTAAAAAGCCATTTTTCTTTCACTTTAAGAAATATGATATCTTTTTTTTTTC
TCTCGACCCAAAAGGAGATAGGCGTGTGCAGATTACAGGCAATGCCCCCTTCGGTCAGTG
CAGCGTGGAGTCGCCGTGTGTGCGTGGGTTGGACTTGTGCGTCCTGGCTGCGTGTCTCAG
GCAGGGCTTTCGTGCTCGCAGTGTCGGGGTGGGAAACCTGTGCCGGATGTCCGAGGGGCT
TTGCAGAAAGCCTGGCAGTGGGCGGCGTGACCTCTGCCTGGGGGCGGAGTGGCTCCTTGG
GGCTGGAAGGCAGTTCTCTTGAGTTGGGGGAGATCTTAGCTGGGGAGAGGGAGGCGGGGG
AAGTGTGCTCCTGCATTTCGTGACACGTACCCTTCGGAGGCGCCCGCGGCCCCCGCCTGT
CTGAGTCTGGGGATCGTAAGCAGGGGGGCAGCCTGGCCCATGGACAGCGTCAGTCCGCCT
GGAGAAACTCCCCTGGGGATCGGCTGTGTCCCACCTGCTGGGGACGGTGTTGGGGCACAG
AGAGGCGATAAACTAAGTGAAAGCAAAGAGCAGCGTTGTCTTCTGCCATTCTTTTGGAGG
TGAGGAGATCCGGTTTCCAGCACTGCCTTGCTCCGAATTGGGAGACGTTTGTCACCTGCC
TTGTTCGCTGTGGCCTCTATTCTAAAGAGCGGAGATCGGATAAAGGAGTTCAGATGTGTT
CTAAGCCTGCTGGAGTGACCACACTTCCAAGACCTGATGGAGGCCAGAGCTCAGAGTGGC
AACGGGTCGCAGCCCTTGCTGCAGACGCCCCGTGACGGTGGCAGACAGCGTGGGGAGCCC
GACCCCAGAGACGCCCTCACCCAGCAGGTACATGTCTTGTCTCTGGATCAGATCAGAGCC
ATCCGAAACACCAATGAGTACACAGAGGGGCCTACTGTCGTCCCAAGACCTGGGCTCAAG
CCTGCTCCTCGCCCCTCCACTCAGCACAAACACGAGAGACTCCACGGTCTGCCTGAGCAC
CGCCAGCCTCCTAGGCTCCAGCACTCGCAGGTCCATTCTTCTGCACGAGCCCCTCTGTCC
AGATCCATAAGCACGGTCAGCTCAGGGTCGCGGAGCAGTACGAGGACAAGTACCAGCAGC
AGCTCCTCTGAACAGAGACTGCTAGGATCATCCTTCTCCTCCGGGCCTGTTGCTGATGGC
ATAATCCGGGTGCAACCCAAATCTGAGCTCAAGCCAGGTGAGCTTAAGCCACTGAGCAAG
GAAGATTTGGGCCTGCACGCCTACAGGTGTGAGGACTGTGGCAAGTGCAAATGTAAGGAG
TGCACCTACCCAAGGCCTCTGCCATCAGACTGGATCTGCGACAAGCAGTGCCTTTGCTCG
GCCCAGAACGTGATTGACTATGGGACTTGTGTATGCTGTGTGAAAGGTCTCTTCTATCAC
TGTTCTAATGATGATGAGGACAACTGTGCTGACAACCCATGTTCTTGCAGCCAGTCTCAC
TGTTGTACACGATGGTCAGCCATGGGTGTCATGTCCCTCTTTTTGCCTTGTTTATGGTGT
TACCTTCCAGCCAAGGGTTGCCTTAAATTGTGCCAGGGGTGTTATGACCGGGTTAACAGG
CCTGGTTGCCGCTGTAAAAACTCAAACACAGTTTGCTGCAAAGTTCCCACTGTCCCCCCT
AGGAACTTTGAAAAACCAACATAGCATCATTAATCAGGAATATTACAGTAATGAGGATTT
TTTCTTTCTTTTTTTAATACACATATGCAACCAACTAAACAGTTATAATCTTGGCACTGT
TAATAGAAAGGTGGGATAGTCTTTGCTGTTTGCGGTGAAATGCTTTTTGTCCATGTGCCG
TTTTAACTGATATGCTTGTTAGAACTCAGCTAATGGAGCTCAAAGTATGAGATACAGAAC
TTGGTGACCCATGTATTGCATAAGCTAAAGCAACACAGACACTCCTAGGCAAAGTTTTTG
TTTGTGAATAGTACTTGCAAAACTTGTAAATTAGCAGATGACTTTTTTCCATTGTTTTCT
CCAGAGAGAATGTGCTATATTTTTGTATATACAATAATATTTGCAACTGTGAAAAACAAG
TTGTGCCATACTACATGGCACAGACACAAAATATTATACTAATATGTTGTACATTCGGAA
GAATGTGAATCAATCAGTATGTTTTTAGATTGTATTTTGCCTTACAGAAAGCCTTTATTG
TAAGACTCTGATTTCCCTTTGGACTTCATGTATATTGTACAGTTACAGTAAAATTCAACC
TTTATTTTCTAATTTTTTCAACATATTGTTTAGTGTAAAGAATATTTATTTGAAGTTTTA
TTATTTTATAAAAAAGAATATTTATTTTAAGAGGCATCTTACAAATTTTGCCCCTTTTAT
GAGGATGTGATAGTTGCTGCAAATGAGGGGTTACAGATGCATATGTCCAATATAAAATAG
AAAATATATTAACGTTTGAAATTAAA

Protein Sequence

>10253 : length: 315
MEARAQSGNGSQPLLQTPRDGGRQRGEPDPRDALTQQVHVLSLDQIRAIRNTNEYTEGPT
VVPRPGLKPAPRPSTQHKHERLHGLPEHRQPPRLQHSQVHSSARAPLSRSISTVSSGSRS
STRTSTSSSSSEQRLLGSSFSSGPVADGIIRVQPKSELKPGELKPLSKEDLGLHAYRCED
CGKCKCKECTYPRPLPSDWICDKQCLCSAQNVIDYGTCVCCVKGLFYHCSNDDEDNCADN
PCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVC
CKVPTVPPRNFEKPT