ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1024

Name

CDK8

Synonym

K35;cyclin-dependent kinase 8;CDK8;cyclin-dependent kinase 8

Definition

CDK8 protein kinase|cell division protein kinase 8|mediator complex subunit CDK8|mediator of RNA polymerase II transcription subunit CDK8|protein kinase K35

Position

13q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Gene Expression;Reactome;REACT:71

Pathway

Generic Transcription Pathway;PID Reactome;500652

External Links

Links to cell senescence gene database

1024

Links to epithelial mesenchymal transition gene database

1024

Links to ovarian cancer gene database

1024

Links to endometrial cancer gene database

1024

Links to iHOP

1024

Sequence Information

Nucleotide Sequence

>1024 : length: 3066
CTTTGAGGAGGTACCGGCTGTTGTGCGGCTCTGCCCTTCTGTTTGAGTGTATGGGAGAGT
GAGTGAGTGAGTGAGTGTGAGCGTGTGTGTGAGAGCGTGAGGCGTGAGTGCGCGTGTGAG
AGGACGAGAGCCCGCCTGGCCGCCCCGCCGCTCCCGCCGCAGCAGGAGCAGAACGCGCGG
CCGGAGAGAGCGGCGGAGCCGGCGCCCAGGGAGCCCGCGGGGACAAGGGCAGAGACACCG
CTCCCCACCCCCAGCCCTCGTCCCTCGGCTCTCCTTCGCCGGGGGATCCTCCCCGTTCCT
CCACCCCCGGCCGGCCTCTGCCCCGCCGTCCCCCTGGATGTCCCTGGCGCTTTCGCGGGG
CCTCCTCCTGCTCTTGCCGCATCAGTCGGGCTGGTGCTGCGGCCGGCGGGCGTAGAGCGG
GCGGGTTCCCGGGGGCTGCGGCTGCCCGTGCTTCCCCGGTCCCCACCCCTGCCCCCCGGC
CCCCCGACCCAGCTCTCCGGCCTCAGAGGCTGTGACAATGGACTATGACTTTAAAGTGAA
GCTGAGCAGCGAGCGGGAGCGGGTCGAGGACCTGTTTGAATACGAGGGCTGCAAAGTTGG
CCGAGGCACTTATGGTCACGTCTACAAAGCCAAGAGGAAAGATGGGAAGGATGATAAAGA
CTATGCTTTAAAACAAATAGAAGGAACTGGGATCTCTATGTCGGCATGTAGAGAAATAGC
ATTACTTCGAGAGCTTAAGCATCCAAACGTCATTTCTCTTCAAAAGGTGTTTCTGTCTCA
TGCTGATAGGAAGGTGTGGCTTCTGTTTGACTATGCTGAACATGACCTCTGGCATATAAT
CAAGTTTCACAGAGCTTCTAAAGCAAACAAGAAGCCAGTTCAGTTACCTCGGGGAATGGT
GAAGTCACTATTATATCAGATCCTAGATGGTATTCACTACCTGCATGCTAACTGGGTGTT
GCACAGAGATTTGAAACCTGCTAATATTTTAGTTATGGGTGAAGGTCCTGAGCGAGGAAG
AGTAAAAATTGCTGACATGGGCTTTGCCCGATTATTTAATTCACCTTTGAAGCCTTTAGC
AGATTTGGATCCAGTGGTTGTTACATTCTGGTACCGAGCCCCTGAACTACTTCTTGGAGC
AAGGCATTATACCAAAGCTATTGATATTTGGGCTATAGGGTGTATATTTGCAGAACTACT
AACGTCAGAACCAATATTTCACTGTCGACAAGAGGACATCAAAACTAGTAATCCTTATCA
CCATGACCAGCTGGACAGAATATTCAATGTAATGGGATTTCCTGCAGATAAAGATTGGGA
AGATATAAAAAAGATGCCTGAACATTCAACATTAATGAAAGATTTCAGAAGAAATACGTA
TACCAACTGCAGCCTTATCAAGTATATGGAAAAACATAAAGTTAAACCAGATAGTAAAGC
ATTCCACTTGCTTCAGAAGCTGCTTACCATGGACCCAATAAAGCGAATTACCTCAGAACA
GGCTATGCAGGACCCCTATTTCTTAGAAGACCCACTTCCTACATCAGACGTTTTTGCCGG
TTGTCAAATCCCTTACCCAAAACGAGAATTTTTAACGGAAGAAGAACCTGATGACAAAGG
AGACAAAAACCAGCAGCAGCAGCAGGGCAATAACCACACTAATGGAACTGGCCACCCAGG
GAATCAAGACAGCAGTCACACACAGGGACCCCCGTTGAAGAAAGTGAGAGTTGTTCCTCC
TACCACTACCTCAGGTGGACTTATCATGACCTCAGACTATCAGCGTTCCAATCCACATGC
TGCCTATCCCAACCCTGGACCAAGCACATCACAGCCGCAGAGCAGCATGGGATACTCAGC
TACCTCCCAGCAGCCTCCACAGTACTCACATCAGACACATCGGTACTGAGCTGCATCGGA
ATCTTGTCCATGCACTGTTGCGAATGCTGCAGGGCTGACTGTGCAGCTCTCTGCGGGAAC
CTGGTATGGGCCATGAGAATGTACTGTACAACCACATCTTCAAAATGTCCAGTAGCCAAG
TTCCACCACTTTTCACAGATTGGGGTAGTGGCTTCCAAGTTGTACCTATTTTGGAGTTAG
ACTTGAAAAGAAAGTGCTAGCACAGTTTGTGTTGTGGATTTGCTACTTCCATAGTTTACT
TGACATGGTTCAGACTGACCAATGCATTTTTTTCAGTGACAGTCTGTAGCAGTTGAAGCT
GTGAATGTGCTAGGGGCAAGCATTTGTCTTTGTATGTGGTGAATTTTTTCAGTGTAACAA
CATTATCTGACCAATAGTACACACACAGACACAAAGTTTAACTGGTACTTGAAACATACA
GTATATGTTAACGAAATAACCAAGACTCGAAATGAGATTATTTTGGTACACCTTTCTTTT
TAGTGTCTTATCAGTGGGCTGATTCATTTTCTACATTAATCAGTGTTTTCTGACCAAGAA
TATTGCTTGGATTTTTTTGAAAGTACAAAAAGCCACATAGTTTTTCCAGAAAGGTTTCAA
AACTCCCAAAGATTAACTTCCAACTTATAAGTTTGTTTTTATTTTCAATCTATGACTTGA
CTGGTATTAAAGCTGCTATTTGATAGTAATTAAATATGTTGTCATTGATATAAACCTGTT
TGGTTCAGCAAACAAACTAAAATGATTGTCATAGACAGTGTTTTATTTTTCCTGTTGGTG
TTGCTGATTTGTGAGCATGCTTTAAGATGAAAAAAGCATGAATGATAACTTCCTTAAAAA
GGTGCGGCATCCAATTCAAATATTTTCGTCCTGATTTTAAAGCTGGTTGGTGTAGTGCTA
TTAAAATTTCGTTCAGTTAATTTTCCTTTTGAAAACTTGTTCGCACGTTGTTTAGGGTGC
CCTTACTTCAGCAAAGGAGAAGGAGTAGGAGAGCCTTAGAATTTTTGAGGAAAAAAAAAC
CTATAACATACAATGTACTGTATCAAACTATTTTACATGAATGACACAAGTATTCTGAAT
AAAAAATAATTGAACATTGTTAAAAACAAGGTGTTATGTAATAAATTTATTTTTCATAAA
TCAAAA

Protein Sequence

>1024 : length: 464
MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYALKQIEGTGIS
MSACREIALLRELKHPNVISLQKVFLSHADRKVWLLFDYAEHDLWHIIKFHRASKANKKP
VQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLF
NSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQED
IKTSNPYHHDQLDRIFNVMGFPADKDWEDIKKMPEHSTLMKDFRRNTYTNCSLIKYMEKH
KVKPDSKAFHLLQKLLTMDPIKRITSEQAMQDPYFLEDPLPTSDVFAGCQIPYPKREFLT
EEEPDDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTS
DYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY