ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10221

Name

TRIB1

Synonym

C8FW|GIG-2|GIG2|SKIP1|TRB-1|TRB1;tribbles pseudokinase 1;TRIB1;tribbles pseudokinase 1

Definition

G-protein-coupled receptor induced protein|G-protein-coupled receptor-induced gene 2 protein|G-protein-coupled receptor-induced protein 2|phosphoprotein regulated by mitogenic pathways|tribbles homolog 1|tribbles-like protein 1

Position

8q24.13

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10221

Links to epithelial mesenchymal transition gene database

10221

Links to ovarian cancer gene database

10221

Links to endometrial cancer gene database

10221

Links to iHOP

10221

Sequence Information

Nucleotide Sequence

>10221 : length: 3649
AAGGAGGAGTGCACTGGCCGGGATCGGTGCAGCGCTCACACTCACTCACAGTCACTCTCT
CTGAGCGCGTCTCGCTCGCTCTCATACACGCCCGGAGCCCAGGAGCGCTCAGGATCCCGA
GCGCCGCGAAAAAGTTCCCCCGGCTTTTGCTGGAGACTCATCGCTTTGGGAAGTGCATTT
GCTTCGTGGCTCCGCCGAGCCTGCTGAATCCTGTCCTCGCGGCTCGGGACCCCGGGATCG
CTGACCGCTGCCGCCGCCGCCTCTGCCTCCCGGACTATCGGCAGCCTCGGCAACAATAGT
GGCGGCCGCCCCCAGCGAGGCTCCGGGAGCCCTTGCCTGCGGGGGTCCGGGGACTCGAGC
CGGCCTCCGCCTCCCGGACGCACAGCCAGCGTGGTCCCCGCGTGCAACGCGAGCGCCGGG
GAGTGGCTCCTGCTTTGCCCCTCGTGGGGGCCGAGCCAAGACCAGTCTGCAAACTCCATC
CCGCCGGCTGGAAGAAGTCGCGGAGCCGGCACCAAACCCGCAGCGTCTTCCCGCGCGGAT
CCCGGGACTTAAAAAGCCGGGGCCACCCCGGCCCAGGACGGGATGCGGGTCGGTCCGGTG
CGCTCTGCCATGAGCGGCGCCTCGCAGCCCCGCGGCCCGGCCCTGCTCTTCCCAGCCACC
CGAGGCGTCCCGGCCAAACGCCTGCTGGACGCCGACGACGCGGCGGCTGTGGCGGCCAAG
TGCCCGCGCCTCTCCGAGTGCTCCAGCCCCCCGGACTACCTCAGCCCCCCCGGCTCGCCC
TGCAGCCCGCAGCCCCCGCCTGCCGCTCCGGGGGCCGGCGGAGGCTCCGGGAGCGCGCCG
GGGCCCAGCCGCATCGCCGACTACCTGCTGCTGCCCCTAGCCGAGCGCGAGCATGTGTCC
CGGGCGCTGTGCATCCACACTGGACGCGAGCTGCGCTGCAAGGTGTTTCCCATTAAACAC
TACCAGGACAAAATCAGGCCTTACATCCAGCTGCCATCGCACAGCAACATTACTGGCATT
GTGGAAGTGATCCTTGGGGAAACCAAGGCCTATGTCTTCTTTGAGAAGGACTTTGGGGAC
ATGCACTCCTATGTGCGAAGCCGGAAGAGGCTGCGGGAAGAGGAAGCCGCCCGGCTCTTC
AAGCAGATTGTCTCCGCCGTCGCCCACTGCCACCAGTCAGCCATCGTGCTGGGGGACCTG
AAGCTTAGGAAGTTCGTCTTCTCCACGGAGGAGAGAACCCAGCTTAGACTAGAAAGTCTA
GAAGACACACACATAATGAAGGGGGAAGATGATGCTTTGTCAGACAAACATGGCTGCCCA
GCCTACGTGAGCCCTGAGATCCTCAACACCACTGGGACCTACTCCGGAAAGGCTGCGGAC
GTTTGGAGCCTGGGGGTGATGCTCTACACCCTTCTGGTTGGACGATACCCCTTCCATGAC
TCAGACCCCAGTGCCCTTTTCTCCAAAATTCGGCGTGGACAGTTCTGCATTCCTGAGCAC
ATTTCCCCCAAAGCCAGGTGCCTCATTCGCAGCCTCTTGAGACGGGAGCCCTCCGAGAGA
CTCACTGCCCCCGAGATCCTACTGCACCCCTGGTTTGAGTCCGTCTTGGAACCCGGGTAC
ATCGACTCAGAAATAGGAACTTCAGACCAGATTGTTCCAGAGTACCAGGAGGACAGTGAC
ATTAGTTCCTTCTTCTGCTAATCCCCAAAACCTCAGAAACCTCATAATTCTTAACACCTG
GCATTTCCATTTCTAAAGATGGACAGGCCCTTTGGCGTGGTACCAACCAGATAATGACTG
CATCAGGATGAAAGCTGCTGAACTCGGCATGGCGCCTCCTCTTCTCTGTTGGGATGAGTG
ACTTTATTGATTTGAGCAGCATATGCTGTGATTGGCTGCCCTGCAAATTTGTTTCCCTTA
AGGAACCCTCACCAACTATCTCTGCTGGATTTGGGAGTTCCGCATCTTTTGTGGAGGGCA
GAGTATGGACATCTTACACCCGGTGGTCAAGTGTGTAATAAACTTGAGCATTCGAATGGG
AGAAAAAGCAAATCGCACAATGACATATTTTGAGTAATAACCGTATTTTTCACAGGGTGA
CAAATTGGGCCAATAAATCTGCCATCTTTGAACTCATCTTTGGTGGCTAGACTGCTACGG
CAGCTTCTCTGATGGGAAAGTTCCTTTTTTGGCTTAACACTCACCCTTTCTTCACACTCA
CATTTACCAATGACTCTGCTCCGTTTTTGGAGCAGACTGTTTTAAGTTGCTCAGGAGCCT
GATGGAACCATGAACCGAGACTCTTCTCTGTTTCCTGCCAAGACCTCATCTGCACTAATG
CCTTCTCCCTGACCTTGACACTTCCCCCTTTAGCTATAAAAGCACTTACCAGCCGAACGT
GGAACAGTATCACAAAAGATTCCATCTCCCAACGATTTCAGAACTCTGAGCTCAGAGAGA
CTCCAGATTTTAAAAAATAATTTGAGTGCTTGGAAACTATTAGCTTTTTAAGTTCCTTCC
AAATATGTTAGTACCTACCCTTTACTTTTTCCCCAAGACCATCTCAGGGTGGAGCATTCT
GTCTAAGAGAAGAAAGATAAGGAGGCTCCCACCCACCTCTCCCAAGAGCAGACATTAAAC
ATCTTTGTGCTTTGAAGAGAGTGAATTTTGGATAGTCTTGTGATTCTCAGACTAACTTCC
AGAATTATACTTTAACCCCTCCCAGATATGGTCCGCCTTTGGCATTGTGTGTACATCTGC
AGTTTTGCATGGTGGGTTGTTAATATTTCAAATGTGTGGTTTATGAATACGTCTGTATAA
TCGGCTTCTGGAGTGAAACAGCAAACCCCAAATCTTCAAAGTTGGAAGGAACTTTAAAAA
TCATCCGGTCCAATCTCTTTCCTCTTTCTGCCACCTCCCAAGGCAGAAATCCCCTCTTCA
GCTTCTTTTGTAGGTGGGAATCCAGCCTCTGTTAGATATGTCCAGAGATGGAAACTCACT
CCCCTACAAAAGATGGAGCTTAATGGAGAAATTGCAACTTTCATTAAAAAACAAATTCAG
ATGAAATATCAGTAACTGTCTTGGACAGTGCTGAAATCAGGTGGTTAAACGGGTAAACAA
AATATACTGTATTTTGAGAAATGGCACAAAAACAGGCAGTCATCTTTAAGGGCTATGCCT
AGGCAAACTACTAACATGCATTGTGAGAATGCCGTGTATACCTCACGTACTGTGTACTTT
GTACATATATTTTACCTTTTATACCTATGTTCGATTTTGTTTTGTTTTGTTTTGTTCTGG
CTTTGAGGCTTGTTTTGTTGTCTGTGTCTGTCTGAATAACCTGCGTGTCTAAAACCACGT
GAAATGTGAATGATTATTGGCAATATTACCTTGACAGAATCATGGGACTTTGAGAAGAGG
GAGGACAGAGGCCTCTGTCGCACTAACGCTCTCGTGGTTGCTCGACTGTTGTATCTGTGA
TACATTATCCGACTAAGGACTCTGGGCTGGCAGGGCCTTCTGCCGGGAAAGCTAGAAACA
CTAGGTTCTTCCTGTACATACGTGTATATATGTGAACAGTGAGATGGCCGTTTCTGACTT
GTAGAGAAATTTTAATAAACCTGGTTTCGTAAATAAAAAAAAAAAAAAA

Protein Sequence

>10221 : length: 372
MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYL
SPPGSPCSPQPPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCK
VFPIKHYQDKIRPYIQLPSHSNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREE
EAARLFKQIVSAVAHCHQSAIVLGDLKLRKFVFSTEERTQLRLESLEDTHIMKGEDDALS
DKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVGRYPFHDSDPSALFSKIRRGQ
FCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSEIGTSDQIVPE
YQEDSDISSFFC