ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1019

Name

CDK4

Synonym

CMM3|PSK-J3;cyclin-dependent kinase 4;CDK4;cyclin-dependent kinase 4

Definition

cell division protein kinase 4

Position

12q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

influence of ras and rho proteins on g1 to s transition;PID BioCarta;100054

Pathway

Cyclin D associated events in G1;PID Reactome;500897

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

T cell receptor signaling pathway;KEGG PATHWAY;hsa04660

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

rb tumor suppressor/checkpoint signaling in response to dna damage;PID BioCarta;100046

Pathway

Calcineurin-regulated NFAT-dependent transcription in lymphocytes;PID Curated;200039

Pathway

p53 signaling pathway;PID BioCarta;100083

Pathway

Ubiquitin-dependent degradation of Cyclin D1;PID Reactome;501007

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

Non-small cell lung cancer;KEGG PATHWAY;hsa05223

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

cyclins and cell cycle regulation;PID BioCarta;100207

Pathway

Tight junction;KEGG PATHWAY;hsa04530

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Disease

Cancers of the nervous system;KEGG DISEASE

Disease

Cancers;KEGG DISEASE

Disease

Cervical cancer;KEGG DISEASE;H00030

Disease

Malignant melanoma;KEGG DISEASE;H00038

Disease

Glioma;KEGG DISEASE;H00042

Disease

Melanoma;OMIM

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

Skin cancers;KEGG DISEASE

External Links

Links to cell senescence gene database

1019

Links to epithelial mesenchymal transition gene database

1019

Links to ovarian cancer gene database

1019

Links to endometrial cancer gene database

1019

Links to iHOP

1019

Sequence Information

Nucleotide Sequence

>1019 : length: 2020
CACCTCCTGTCCGCCCCTCAGCGCATGGGTGGCGGTCACGTGCCCAGAACGTCCGGCGTT
CGCCCCGCCCTCCCAGTTTCCGCGCGCCTCTTTGGCAGCTGGTCACATGGTGAGGGTGGG
GGTGAGGGGGCCTCTCTAGCTTGCGGCCTGTGTCTATGGTCGGGCCCTCTGCGTCCAGCT
GCTCCGGACCGAGCTCGGGTGTATGGGGCCGTAGGAACCGGCTCCGGGGCCCCGATAACG
GGCCGCCCCCACAGCACCCCGGGCTGGCGTGAGGGTCTCCCTTGATCTGAGAATGGCTAC
CTCTCGATATGAGCCAGTGGCTGAAATTGGTGTCGGTGCCTATGGGACAGTGTACAAGGC
CCGTGATCCCCACAGTGGCCACTTTGTGGCCCTCAAGAGTGTGAGAGTCCCCAATGGAGG
AGGAGGTGGAGGAGGCCTTCCCATCAGCACAGTTCGTGAGGTGGCTTTACTGAGGCGACT
GGAGGCTTTTGAGCATCCCAATGTTGTCCGGCTGATGGACGTCTGTGCCACATCCCGAAC
TGACCGGGAGATCAAGGTAACCCTGGTGTTTGAGCATGTAGACCAGGACCTAAGGACATA
TCTGGACAAGGCACCCCCACCAGGCTTGCCAGCCGAAACGATCAAGGATCTGATGCGCCA
GTTTCTAAGAGGCCTAGATTTCCTTCATGCCAATTGCATCGTTCACCGAGATCTGAAGCC
AGAGAACATTCTGGTGACAAGTGGTGGAACAGTCAAGCTGGCTGACTTTGGCCTGGCCAG
AATCTACAGCTACCAGATGGCACTTACACCCGTGGTTGTTACACTCTGGTACCGAGCTCC
CGAAGTTCTTCTGCAGTCCACATATGCAACACCTGTGGACATGTGGAGTGTTGGCTGTAT
CTTTGCAGAGATGTTTCGTCGAAAGCCTCTCTTCTGTGGAAACTCTGAAGCCGACCAGTT
GGGCAAAATCTTTGACCTGATTGGGCTGCCTCCAGAGGATGACTGGCCTCGAGATGTATC
CCTGCCCCGTGGAGCCTTTCCCCCCAGAGGGCCCCGCCCAGTGCAGTCGGTGGTACCTGA
GATGGAGGAGTCGGGAGCACAGCTGCTGCTGGAAATGCTGACTTTTAACCCACACAAGCG
AATCTCTGCCTTTCGAGCTCTGCAGCACTCTTATCTACATAAGGATGAAGGTAATCCGGA
GTGAGCAATGGAGTGGCTGCCATGGAAGGAAGAAAAGCTGCCATTTCCCTTCTGGACACT
GAGAGGGCAATCTTTGCCTTTATCTCTGAGGCTATGGAGGGTCCTCCTCCATCTTTCTAC
AGAGATTACTTTGCTGCCTTAATGACATTCCCCTCCCACCTCTCCTTTTGAGGCTTCTCC
TTCTCCTTCCCATTTCTCTACACTAAGGGGTATGTTCCCTCTTGTCCCTTTCCCTACCTT
TATATTTGGGGTCCTTTTTTATACAGGAAAAACAAAACAAAGAAATAATGGTCTTTTTTT
TTTTTTTAATGTTTCTTCCTCTGTTTGGCTTTGCCATTGTGCGATTTGGAAAAACCACTT
GGAAGAAGGGACTTTCCTGCAAAACCTTAAAGACTGGTTAAATTACAGGGCCTAGGAAGT
CAGTGGAGCCCCTTGACTGACAAAGCTTAGAAAGGAACTGAAATTGCTTCTTTGAATATG
GATTTTAGGCGGGGCGTGGTGGCTCACGCCTATAATCCCAGCACGTTGGGAGGCCAACGC
GGGTGGATCACCTGAGGTCAGGAGTTCGAGACCAGCCTGACTAACATGGTGAAACCCTGT
CTCTACTAAAAATACAAAATTAGTCAGGCGTGGTGGTGCACACCTGTAATCCCAGCTACT
TGGGAGACTGAGGCAGGAGGATCGCTTGAACCCGGGAGGCAGAGGTTGCGGTGAGCCGAG
ATCATGCCATTGCACTCCAGCCTGGGCAACAGAGCAAGACTCTGTGTCAAAAAAAAAAAA
AGAATATAGATTTTTAAATGGCAAAAAAAAAAAAAAAAAA

Protein Sequence

>1019 : length: 303
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE