ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10158

Name

PDZK1IP1

Synonym

DD96|MAP17|SPAP;PDZK1 interacting protein 1;PDZK1IP1;PDZK1 interacting protein 1

Definition

17 kDa membrane-associated protein|PDZK1-interacting protein 1|epithelial protein up-regulated in carcinoma, membrane associated protein 17|membrane-associated protein 17

Position

1p33

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10158

Links to epithelial mesenchymal transition gene database

10158

Links to ovarian cancer gene database

10158

Links to endometrial cancer gene database

10158

Links to iHOP

10158

Sequence Information

Nucleotide Sequence

>10158 : length: 894
GCCCGTCTTCGTGTCTCCTCCCTCCCTCGCCTTCCTCCTTCCTAGCTCCTCTCCTCCAGG
GCCAGACTGAGCCCAGGTTGATTTCAGGCGGACACCAATAGACTCCACAGCAGCTCCAGG
AGCCCAGACACCGGCGGCCAGAAGCAAGGCTAGGAGCTGCTGCAGCCATGTCGGCCCTCA
GCCTCCTCATTCTGGGCCTGCTCACGGCAGTGCCACCTGCCAGCTGTCAGCAAGGCCTGG
GGAACCTTCAGCCCTGGATGCAGGGCCTTATCGCGGTGGCCGTGTTCCTGGTCCTCGTTG
CAATCGCCTTTGCAGTCAACCACTTCTGGTGCCAGGAGGAGCCGGAGCCTGCACACATGA
TCCTGACCGTCGGAAACAAGGCAGATGGAGTCCTGGTGGGAACAGATGGAAGGTACTCTT
CGATGGCGGCCAGTTTCAGGTCCAGTGAGCATGAGAATGCCTATGAGAATGTGCCCGAGG
AGGAAGGCAAGGTCCGCAGCACCCCGATGTAACCTTCTCTGTGGCTCCAACCCCAAGACT
CCCAGGCACATGGGATGGATGTCCAGTGCTACCACCCAAGCCCCCTCCTTCTTTGTGTGG
AATCTGCAATAGTGGGCTGACTCCCTCCAGCCCCATGCCGGCCCTACCCGCCCTTGAAGT
ATAGCCAGCCAAGGTTGGAGCTCAGACCGTGTCTAGGTTGGGGCTCGGCTGTGGCCCTGG
GGTCTCCTGCTCAGCTCAGAAGAGCCTTCTGGAGAGGACAGTCAGCTGAGCACCTCCCAT
CCTGCTCACACGTCCTTCCCCATAACTATGGAAATGGCCCTAATTTCTGTGAAATAAAGA
CTTTTTGTATTTCTGGGGCTGAGGCTCAGCAACAGCCCCTCAGGCTTCCAGTGA

Protein Sequence

>10158 : length: 114
MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPE
PAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM