ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10155

Name

TRIM28

Synonym

KAP1|PPP1R157|RNF96|TF1B|TIF1B;tripartite motif containing 28;TRIM28;tripartite motif containing 28

Definition

E3 SUMO-protein ligase TRIM28|KAP-1|KRAB [Kruppel-associated box domain]-associated protein 1|KRAB-associated protein 1|KRAB-interacting protein 1|KRIP-1|RING finger protein 96|TIF1-beta|nuclear corepressor KAP-1|protein phosphatase 1, regulatory subunit

Position

19q13.4

Gene Type

protein-coding

Pathways and Diseases

Pathway

E2F transcription factor network;PID Curated;200027

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

p53 pathway;PID Curated;200175

Disease

Abortion;FunDO

External Links

Links to cell senescence gene database

10155

Links to epithelial mesenchymal transition gene database

10155

Links to ovarian cancer gene database

10155

Links to endometrial cancer gene database

10155

Links to iHOP

10155

Sequence Information

Nucleotide Sequence

>10155 : length: 2989
GGCGCGCGGGCGAGCGGTTGTGCTTGTGCTTGTGGCGCGTGGTGCGGGTTTCGGCGGCGG
CTGAGGAAGAAGCGCGGGCGGCGCCTTCGGGAGGCGAGCAGGCAGCAGTTGGCCGTGCCG
TAGCAGCGTCCCGCGCGCGGCGGGCAGCGGCCCAGGAGGCGCGTGGCGGCGCTCGGCCTC
GCGGCGGCGGCGGCGGCAGCGGCCCAGCAGTTGGCGGCGAGCGCGTCTGCGCCTGCGCGG
CGGGCCCCGCGCCCCTCCTCCCCCCCTGGGCGCCCCCGGCGGCGTGTGAATGGCGGCCTC
CGCGGCGGCAGCCTCGGCAGCAGCGGCCTCGGCCGCCTCTGGCAGCCCGGGCCCGGGCGA
GGGCTCCGCTGGCGGCGAAAAGCGCTCCACCGCCCCTTCGGCCGCAGCCTCGGCCTCTGC
CTCAGCCGCGGCGTCGTCGCCCGCGGGGGGCGGCGCCGAGGCGCTGGAGCTGCTGGAGCA
CTGCGGCGTGTGCAGAGAGCGCCTGCGACCCGAGAGGGAGCCCCGCCTGCTGCCCTGTTT
GCACTCGGCCTGTAGTGCCTGCTTAGGGCCCGCGGCCCCCGCCGCCGCCAACAGCTCGGG
GGACGGCGGGGCGGCGGGCGACGGCACCGTGGTGGACTGTCCCGTGTGCAAGCAACAGTG
CTTCTCCAAAGACATCGTGGAGAATTATTTCATGCGTGATAGTGGCAGCAAGGCTGCCAC
CGACGCCCAGGATGCGAACCAGTGCTGCACTAGCTGTGAGGATAATGCCCCAGCCACCAG
CTACTGTGTGGAGTGCTCGGAGCCTCTGTGTGAGACCTGTGTAGAGGCGCACCAGCGGGT
GAAGTACACCAAGGACCATACTGTGCGCTCTACTGGGCCAGCCAAGTCTCGGGATGGTGA
ACGTACTGTCTATTGCAACGTACACAAGCATGAACCCCTTGTGCTGTTTTGTGAGAGCTG
TGATACTCTCACCTGCCGAGACTGCCAGCTCAATGCCCACAAGGACCACCAGTACCAGTT
CTTAGAGGATGCAGTGAGGAACCAGCGCAAGCTCCTGGCCTCACTGGTGAAGCGCCTTGG
GGACAAACATGCAACATTGCAGAAGAGCACCAAGGAGGTTCGCAGCTCAATCCGCCAGGT
GTCTGACGTACAGAAGCGTGTGCAAGTGGATGTCAAGATGGCCATCCTGCAGATCATGAA
GGAGCTGAATAAGCGGGGCCGTGTGCTGGTCAATGATGCCCAGAAGGTGACTGAGGGGCA
GCAGGAGCGCCTGGAGCGGCAGCACTGGACCATGACCAAGATCCAGAAGCACCAGGAGCA
CATTCTGCGCTTTGCCTCTTGGGCTCTGGAGAGTGACAACAACACAGCCCTTTTGCTTTC
TAAGAAGTTGATCTACTTCCAGCTGCACCGGGCCCTCAAGATGATTGTGGATCCCGTGGA
GCCACATGGCGAGATGAAGTTTCAGTGGGACCTCAATGCCTGGACCAAGAGTGCCGAGGC
CTTTGGCAAGATTGTGGCAGAGCGTCCTGGCACTAACTCAACAGGCCCTGCACCCATGGC
CCCTCCAAGAGCCCCAGGGCCCCTGAGCAAGCAGGGCTCTGGCAGCAGCCAGCCCATGGA
GGTGCAGGAAGGCTATGGCTTTGGGTCAGGAGATGATCCCTACTCAAGTGCAGAGCCCCA
TGTGTCAGGTGTGAAACGGTCCCGCTCAGGTGAGGGCGAGGTGAGCGGCCTTATGCGCAA
GGTGCCACGAGTGAGCCTTGAACGCCTGGACCTGGACCTCACAGCTGACAGCCAGCCACC
CGTCTTCAAGGTCTTCCCAGGCAGTACCACTGAGGACTACAACCTTATTGTTATTGAACG
TGGCGCTGCCGCTGCAGCTACCGGCCAGCCAGGGACTGCGCCTGCAGGAACCCCTGGTGC
CCCACCCCTGGCTGGCATGGCCATTGTCAAGGAGGAGGAGACGGAGGCTGCCATTGGAGC
CCCTCCTACTGCCACTGAGGGCCCTGAGACCAAACCTGTGCTTATGGCTCTTGCGGAGGG
TCCTGGTGCTGAGGGTCCCCGCCTGGCCTCACCTAGTGGCAGCACCAGCTCAGGGCTGGA
GGTGGTGGCTCCTGAGGGTACCTCAGCCCCAGGTGGTGGCCCGGGAACCCTGGATGACAG
TGCCACCATTTGCCGTGTCTGCCAGAAGCCAGGCGATCTGGTTATGTGCAACCAGTGTGA
GTTTTGTTTCCACCTGGACTGTCACCTGCCGGCCCTGCAGGATGTACCAGGGGAGGAGTG
GAGCTGCTCACTCTGCCATGTGCTCCCTGACCTGAAGGAGGAGGATGGCAGCCTCAGCCT
GGATGGTGCAGACAGCACTGGCGTGGTGGCCAAGCTCTCACCAGCCAACCAGCGGAAATG
TGAGCGTGTACTGCTGGCCCTATTCTGTCACGAACCCTGCCGCCCCCTGCATCAGCTGGC
TACCGACTCCACCTTCTCCCTGGACCAGCCCGGTGGCACCCTGGATCTGACCCTGATCCG
TGCCCGCCTCCAGGAGAAGTTGTCACCTCCCTACAGCTCCCCACAGGAGTTTGCCCAGGA
TGTGGGCCGCATGTTCAAGCAATTCAACAAGTTAACTGAGGACAAGGCAGACGTGCAGTC
CATCATCGGCCTGCAGCGCTTCTTCGAGACGCGCATGAACGAGGCCTTCGGTGACACCAA
GTTCTCTGCTGTGCTGGTGGAGCCCCCGCCGATGAGCCTGCCTGGTGCTGGCCTGAGTTC
CCAGGAGCTGTCTGGTGGCCCTGGTGATGGCCCCTGAGGCTGGAGCCCCCATGGCCAGCC
CAGCCTGGCTCTGTTCTCTGTCCTGTCACCCCATCCCCACTCCCCTGGTGGCCTGACTCC
CACTCCCTGGTGGCCCCATCCCCCAGTTCCTCACGATATGGTTTTTACTTCTGTGGATTT
AATAAAAACTTCACCAGTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>10155 : length: 835
MAASAAAASAAAASAASGSPGPGEGSAGGEKRSTAPSAAASASASAAASSPAGGGAEALE
LLEHCGVCRERLRPEREPRLLPCLHSACSACLGPAAPAAANSSGDGGAAGDGTVVDCPVC
KQQCFSKDIVENYFMRDSGSKAATDAQDANQCCTSCEDNAPATSYCVECSEPLCETCVEA
HQRVKYTKDHTVRSTGPAKSRDGERTVYCNVHKHEPLVLFCESCDTLTCRDCQLNAHKDH
QYQFLEDAVRNQRKLLASLVKRLGDKHATLQKSTKEVRSSIRQVSDVQKRVQVDVKMAIL
QIMKELNKRGRVLVNDAQKVTEGQQERLERQHWTMTKIQKHQEHILRFASWALESDNNTA
LLLSKKLIYFQLHRALKMIVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGP
APMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSG
LMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIERGAAAAATGQPGTAPAG
TPGAPPLAGMAIVKEEETEAAIGAPPTATEGPETKPVLMALAEGPGAEGPRLASPSGSTS
SGLEVVAPEGTSAPGGGPGTLDDSATICRVCQKPGDLVMCNQCEFCFHLDCHLPALQDVP
GEEWSCSLCHVLPDLKEEDGSLSLDGADSTGVVAKLSPANQRKCERVLLALFCHEPCRPL
HQLATDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKA
DVQSIIGLQRFFETRMNEAFGDTKFSAVLVEPPPMSLPGAGLSSQELSGGPGDGP