ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

1015

Name

CDH17

Synonym

CDH16|HPT-1|HPT1;cadherin 17, LI cadherin (liver-intestine);CDH17;cadherin 17, LI cadherin (liver-intestine)

Definition

HPT-1 cadherin|LI cadherin|LI-cadherin|cadherin-16|cadherin-17|human intestinal peptide-associated transporter HPT-1|human peptide transporter 1|intestinal peptide-associated transporter HPT-1|liver-intestine cadherin

Position

8q22.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

Cadherin signaling pathway;PANTHER;P00012

External Links

Links to cell senescence gene database

1015

Links to epithelial mesenchymal transition gene database

1015

Links to ovarian cancer gene database

1015

Links to endometrial cancer gene database

1015

Links to iHOP

1015

Sequence Information

Nucleotide Sequence

>1015 : length: 3699
AATCACGGTGGAAGTATGATATTTTGGCTGTGGATCTGAGTTGATCAATCTGCTTAGTGG
ACTTGAGTCCCCCCACCCCCGCTTGTCTGATTGGGGCTCCTGGGAGGAATTTGAATAAAG
AAAACTATGATACTTCAGGCCCATCTTCACTCCCTGTGTCTTCTTATGCTTTATTTGGCA
ACTGGATATGGCCAAGAGGGGAAGTTTAGTGGACCCCTGAAACCCATGACATTTTCTATT
TATGAAGGCCAAGAACCGAGTCAAATTATATTCCAGTTTAAGGCCAATCCTCCTGCTGTG
ACTTTTGAACTAACTGGGGAGACAGACAACATATTTGTGATAGAACGGGAGGGACTTCTG
TATTACAACAGAGCCTTGGACAGGGAAACAAGATCTACTCACAATCTCCAGGTTGCAGCC
CTGGACGCTAATGGAATTATAGTGGAGGGTCCAGTCCCTATCACCATAAAAGTGAAGGAC
ATCAACGACAATCGACCCACGTTTCTCCAGTCAAAGTACGAAGGCTCAGTAAGGCAGAAC
TCTCGCCCAGGAAAGCCCTTCTTGTATGTCAATGCCACAGACCTGGATGATCCGGCCACT
CCCAATGGCCAGCTTTATTACCAGATTGTCATCCAGCTTCCCATGATCAACAATGTCATG
TACTTTCAGATCAACAACAAAACGGGAGCCATCTCTCTTACCCGAGAGGGATCTCAGGAA
TTGAATCCTGCTAAGAATCCTTCCTATAATCTGGTGATCTCAGTGAAGGACATGGGAGGC
CAGAGTGAGAATTCCTTCAGTGATACCACATCTGTGGATATCATAGTGACAGAGAATATT
TGGAAAGCACCAAAACCTGTGGAGATGGTGGAAAACTCAACTGATCCTCACCCCATCAAA
ATCACTCAGGTGCGGTGGAATGATCCCGGTGCACAATATTCCTTAGTTGACAAAGAGAAG
CTGCCAAGATTCCCATTTTCAATTGACCAGGAAGGAGATATTTACGTGACTCAGCCCTTG
GACCGAGAAGAAAAGGATGCATATGTTTTTTATGCAGTTGCAAAGGATGAGTACGGAAAA
CCACTTTCATATCCGCTGGAAATTCATGTAAAAGTTAAAGATATTAATGATAATCCACCT
ACATGTCCGTCACCAGTAACCGTATTTGAGGTCCAGGAGAATGAACGACTGGGTAACAGT
ATCGGGACCCTTACTGCACATGACAGGGATGAAGAAAATACTGCCAACAGTTTTCTAAAC
TACAGGATTGTGGAGCAAACTCCCAAACTTCCCATGGATGGACTCTTCCTAATCCAAACC
TATGCTGGAATGTTACAGTTAGCTAAACAGTCCTTGAAGAAGCAAGATACTCCTCAGTAC
AACTTAACGATAGAGGTGTCTGACAAAGATTTCAAGACCCTTTGTTTTGTGCAAATCAAC
GTTATTGATATCAATGATCAGATCCCCATCTTTGAAAAATCAGATTATGGAAACCTGACT
CTTGCTGAAGACACAAACATTGGGTCCACCATCTTAACCATCCAGGCCACTGATGCTGAT
GAGCCATTTACTGGGAGTTCTAAAATTCTGTATCATATCATAAAGGGAGACAGTGAGGGA
CGCCTGGGGGTTGACACAGATCCCCATACCAACACCGGATATGTCATAATTAAAAAGCCT
CTTGATTTTGAAACAGCAGCTGTTTCCAACATTGTGTTCAAAGCAGAAAATCCTGAGCCT
CTAGTGTTTGGTGTGAAGTACAATGCAAGTTCTTTTGCCAAGTTCACGCTTATTGTGACA
GATGTGAATGAAGCACCTCAATTTTCCCAACACGTATTCCAAGCGAAAGTCAGTGAGGAT
GTAGCTATAGGCACTAAAGTGGGCAATGTGACTGCCAAGGATCCAGAAGGTCTGGACATA
AGCTATTCACTGAGGGGAGACACAAGAGGTTGGCTTAAAATTGACCACGTGACTGGTGAG
ATCTTTAGTGTGGCTCCATTGGACAGAGAAGCCGGAAGTCCATATCGGGTACAAGTGGTG
GCCACAGAAGTAGGGGGGTCTTCCTTGAGCTCTGTGTCAGAGTTCCACCTGATCCTTATG
GATGTGAATGACAACCCTCCCAGGCTAGCCAAGGACTACACGGGCTTGTTCTTCTGCCAT
CCCCTCAGTGCACCTGGAAGTCTCATTTTCGAGGCTACTGATGATGATCAGCACTTATTT
CGGGGTCCCCATTTTACATTTTCCCTCGGCAGTGGAAGCTTACAAAACGACTGGGAAGTT
TCCAAAATCAATGGTACTCATGCCCGACTGTCTACCAGGCACACAGAGTTTGAGGAGAGG
GAGTATGTCGTCTTGATCCGCATCAATGATGGGGGTCGGCCACCCTTGGAAGGCATTGTT
TCTTTACCAGTTACATTCTGCAGTTGTGTGGAAGGAAGTTGTTTCCGGCCAGCAGGTCAC
CAGACTGGGATACCCACTGTGGGCATGGCAGTTGGTATACTGCTGACCACCCTTCTGGTG
ATTGGTATAATTTTAGCAGTTGTGTTTATCCGCATAAAGAAGGATAAAGGCAAAGATAAT
GTTGAAAGTGCTCAAGCATCTGAAGTCAAACCTCTGAGAAGCTGAATTTGAAAAGGAATG
TTTGAATTTATATAGCAAGTGCTATTTCAGCAACAACCATCTCATCCTATTACTTTTCAT
CTAACGTGCATTATAATTTTTTAAACAGATATTCCCTCTTGTCCTTTAATATTTGCTAAA
TATTTCTTTTTTGAGGTGGAGTCTTGCTCTGTCGCCCAGGCTGGAGTACAGTGGTGTGAT
CCCAGCTCACTGCAACCTCCGCCTCCTGGGTTCACATGATTCTCCTGCCTCAGCTTCCTA
AGTAGCTGGGTTTACAGGCACCCACCACCATGCCCAGCTAATTTTTGTATTTTTAATAGA
GACGGGGTTTCGCCATTTGGCCAGGCTGGTCTTGAACTCCTGACGTCAAGTGATCTGCCT
GCCTTGGTCTCCCAATACAGGCATGAACCACTGCACCCACCTACTTAGATATTTCATGTG
CTATAGACATTAGAGAGATTTTTCATTTTTCCATGACATTTTTCCTCTCTGCAAATGGCT
TAGCTACTTGTGTTTTTCCCTTTTGGGGCAAGACAGACTCATTAAATATTCTGTACATTT
TTTCTTTATCAAGGAGATATATCAGTGTTGTCTCATAGAACTGCCTGGATTCCATTTATG
TTTTTTCTGATTCCATCCTGTGTCCCCTTCATCCTTGACTCCTTTGGTATTTCACTGAAT
TTCAAACATTTGTCAGAGAAGAAAAACGTGAGGACTCAGGAAAAATAAATAAATAAAAGA
ACAGCCTTTTCCCTTAGTATTAACAGAAATGTTTCTGTGTCATTAACCATCTTTAATCAA
TGTGACATGTTGCTCTTTGGCTGAAATTCTTCAACTTGGAAATGACACAGACCCACAGAA
GGTGTTCAAACACAACCTACTCTGCAAACCTTGGTAAAGGAACCAGTCAGCTGGCCAGAT
TTCCTCACTACCTGCCATGCATACATGCTGCGCATGTTTTCTTCATTCGTATGTTAGTAA
AGTTTTGGTTATTATATATTTAACATGTGGAAGAAAACAAGACATGAAAAGAGTGGTGAC
AAATCAAGAATAAACACTGGTTGTAGTCAGTTTTGTTTG

Protein Sequence

>1015 : length: 832
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS