ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10142

Name

AKAP9

Synonym

AKAP-9|AKAP350|AKAP450|CG-NAP|HYPERION|LQT11|MU-RMS-40.16A|PPP1R45|PRKA9|YOTIAO;A kinase (PRKA) anchor protein 9;AKAP9;A kinase (PRKA) anchor protein 9

Definition

A kinase (PRKA) anchor protein (yotiao) 9|A-kinase anchor protein 350 kDa|A-kinase anchor protein 450 kDa|A-kinase anchor protein 9|AKAP 120-like protein|AKAP9-BRAF fusion protein|centrosome- and Golgi-localized PKN-associated protein|centrosome- and golg

Position

7q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Pathway

protein kinase a at the centrosome;PID BioCarta;100246

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Disease

Long QT syndrome;FunDO

Disease

Breast cancer;FunDO

Disease

Long QT syndrome-11;OMIM

Disease

Papillary cancer;FunDO

External Links

Links to cell senescence gene database

10142

Links to epithelial mesenchymal transition gene database

10142

Links to ovarian cancer gene database

10142

Links to endometrial cancer gene database

10142

Links to iHOP

10142

Sequence Information

Nucleotide Sequence

>10142 : length: 13074
TACGTGGAGACGAAGATGGCGGCGGCGGCGGCGGTGACGGCGCTTCCCGTGCGGCTGAGG
ACGATCCGCCAGTGAGCGCGGAGACTGCTTCCACTTCGGGCGGGGGAGCGCCGGACCGAA
TCGGCTCTCTAGGCCGTGGAGCTTGCCGTCCCACCTCCGTCCAAATCGACCTTTCCTTTC
TATCCCCAACCACCCCTCAACCCCTGTTTTCCCCTGCCTTCCTTGCAGAGGCCATGGAGG
ACGAGGAGAGACAGAAGAAGCTGGAGGCCGGCAAAGCCAAGCTTGCCCAGTTTCGACAAA
GAAAAGCTCAGTCGGATGGGCAGAGTCCTTCCAAGAAGCAGAAAAAAAAGAGAAAAACGT
CAAGCAGTAAACATGATGTGTCAGCACACCATGATTTGAATATTGATCAATCACAGTGTA
ATGAAATGTACATAAATAGTTCTCAGAGAGTAGAATCAACTGTGATTCCTGAATCTACAA
TAATGAGAACTCTACATAGTGGAGAAATAACCAGTCATGAGCAGGGCTTCTCTGTGGAAC
TGGAAAGTGAAATTTCAACCACAGCAGATGACTGCAGTTCAGAGGTAAATGGTTGCAGTT
TTGTGATGAGAACAGGAAAGCCTACAAATTTATTAAGGGAAGAAGAATTTGGTGTTGATG
ATTCTTATTCTGAACAAGGAGCACAAGACAGTCCGACTCATCTAGAGATGATGGAAAGTG
AGTTGGCTGGGAAGCAGCATGAGATTGAAGAGCTAAACAGAGAGCTGGAAGAAATGAGGG
TTACCTATGGGACTGAAGGACTGCAGCAGTTACAAGAATTTGAAGCTGCCATTAAACAAA
GAGATGGCATTATAACCCAGCTCACTGCTAATTTACAACAAGCAAGAAGAGAAAAGGATG
AGACAATGAGAGAATTTTTAGAGTTGACAGAACAGAGTCAAAAATTACAGATTCAATTTC
AGCAATTACAGGCTAGTGAAACTCTGAGAAACAGCACTCATAGTAGCACAGCTGCAGACT
TACTACAAGCCAAACAACAGATCCTCACTCATCAACAGCAGCTTGAAGAACAAGACCACT
TATTAGAAGATTATCAGAAAAAGAAAGAAGACTTCACAATGCAAATTAGTTTCTTGCAAG
AGAAAATTAAAGTATATGAAATGGAACAAGATAAAAAAGTAGAAAACTCAAATAAAGAAG
AAATACAGGAAAAGGAGACAATCATTGAAGAATTAAACACAAAAATAATAGAAGAAGAAA
AGAAAACTCTTGAGCTAAAGGATAAATTAACAACTGCTGATAAATTACTAGGAGAATTAC
AAGAACAGATTGTGCAAAAGAACCAAGAAATAAAAAACATGAAATTAGAGCTGACTAATT
CTAAGCAAAAAGAAAGACAGTCTTCTGAAGAAATAAAACAGTTAATGGGGACAGTCGAAG
AACTTCAGAAGAGAAATCATAAAGACAGCCAGTTCGAAACTGATATAGTACAACGAATGG
AACAAGAAACACAAAGAAAGTTAGAACAACTCCGGGCAGAGCTGGATGAGATGTATGGGC
AGCAGATAGTGCAAATGAAACAAGAATTAATAAGACAACACATGGCACAGATGGAGGAAA
TGAAAACACGGCATAAGGGAGAAATGGAGAATGCTTTAAGGTCATATTCAAATATTACAG
TTAATGAAGATCAGATAAAGTTAATGAATGTGGCAATAAATGAACTGAATATAAAATTGC
AAGATACTAACTCTCAAAAGGAAAAACTCAAGGAAGAACTAGGACTAATTTTAGAAGAAA
AGTGTGCTCTACAGAGACAGCTTGAAGACCTTGTTGAAGAATTGAGCTTTTCAAGGGAAC
AGATTCAGAGAGCTAGACAGACAATAGCTGAACAAGAAAGTAAACTTAATGAAGCACATA
AGTCCCTTAGTACAGTGGAAGATTTGAAAGCTGAGATTGTTTCTGCATCTGAATCCAGAA
AGGAACTAGAATTAAAACATGAAGCAGAAGTTACAAATTACAAGATAAAACTTGAAATGT
TAGAAAAAGAAAAGAATGCTGTGTTAGACAGAATGGCTGAATCACAAGAAGCTGAATTAG
AGAGGCTGAGAACACAGCTTCTATTTAGTCACGAAGAAGAGCTTTCCAAACTGAAGGAAG
ATTTAGAAATTGAACATCGAATAAATATTGAAAAACTTAAAGATAATTTAGGCATTCACT
ATAAACAGCAGATAGATGGTTTACAGAATGAAATGAGTCAAAAGATAGAAACCATGCAGT
TTGAAAAGGACAATTTGATAACTAAGCAGAATCAATTAATTTTGGAAATTTCAAAGCTAA
AAGATTTACAGCAGTCTCTTGTAAATTCAAAGTCAGAAGAAATGACTCTTCAAATCAATG
AACTTCAAAAAGAAATTGAAATACTCAGACAAGAAGAAAAAGAAAAGGGTACACTTGAAC
AAGAAGTTCAAGAATTACAACTTAAAACAGAATTGTTAGAAAAACAGATGAAGGAAAAAG
AGAATGATCTTCAAGAAAAATTTGCACAACTTGAAGCAGAGAATAGCATTCTTAAAGATG
AAAAGAAAACCCTTGAAGACATGTTGAAAATACATACTCCTGTTAGCCAAGAAGAAAGAT
TGATTTTCTTAGACTCCATTAAGTCCAAATCCAAAGACTCTGTGTGGGAAAAAGAAATAG
AAATACTTATAGAGGAAAATGAGGACCTCAAACAACAATGTATTCAGCTAAATGAAGAGA
TTGAAAAGCAAAGGAACACTTTTTCATTTGCTGAAAAAAACTTTGAAGTTAACTATCAAG
AGTTACAAGAGGAGTATGCTTGCCTTCTCAAAGTAAAAGATGATTTAGAAGACAGTAAAA
ATAAACAGGAATTAGAGTATAAAAGTAAACTTAAAGCACTTAATGAAGAGCTTCATTTGC
AAAGAATAAATCCAACTACAGTGAAAATGAAAAGTTCTGTCTTTGATGAAGACAAAACTT
TTGTAGCAGAAACATTGGAAATGGGTGAGGTTGTTGAAAAGGATACAACAGAACTCATGG
AAAAACTTGAGGTAACCAAGCGAGAGAAATTAGAGCTGTCACAGAGACTGTCTGATCTTT
CTGAACAATTGAAACAGAAACATGGTGAGATTAGTTTTCTAAATGAAGAAGTTAAATCTT
TAAAGCAAGAGAAAGAACAAGTTTCATTGAGATGTAGAGAGCTAGAAATCATTATTAACC
ACAACAGGGCAGAAAATGTACAGTCATGTGATACTCAAGTAAGCTCTTTATTAGATGGAG
TTGTGACCATGACAAGCAGGGGTGCTGAAGGATCAGTTTCTAAAGTAAATAAAAGTTTTG
GTGAAGAATCAAAAATAATGGTGGAAGATAAAGTTTCTTTTGAAAATATGACTGTTGGAG
AAGAAAGTAAGCAAGAACAGTTGATTTTGGATCACTTACCATCTGTAACAAAGGAATCAT
CACTTAGAGCAACTCAACCAAGTGAAAATGATAAACTTCAGAAAGAACTCAATGTACTTA
AATCAGAACAGAATGATTTAAGGCTACAGATGGAAGCCCAACGCATTTGCCTCTCTCTGG
TTTATTCAACTCATGTGGATCAGGTTCGTGAATATATGGAAAATGAAAAAGATAAAGCTC
TTTGCAGTCTTAAAGAAGAGCTTATTTTTGCTCAAGAGGAAAAGATCAAGGAACTTCAGA
AAATACACCAGTTAGAACTACAGACTATGAAAACACAAGAAACAGGTGATGAAGGAAAGC
CTTTACATCTGCTCATTGGAAAACTTCAAAAGGCAGTGTCTGAAGAATGTTCTTATTTTT
TACAGACTTTATGCAGTGTCCTTGGTGAATATTATACTCCTGCTTTAAAATGTGAAGTAA
ATGCAGAAGACAAAGAGAATTCTGGTGATTACATTTCTGAAAATGAAGATCCAGAATTAC
AAGATTATAGATATGAAGTTCAAGACTTTCAAGAAAATATGCACACTCTTCTCAACAAAG
TAACAGAAGAATACAACAAACTCTTGGTACTTCAAACACGACTAAGCAAGATCTGGGGAC
AGCAGACAGATGGTATGAAACTTGAATTTGGAGAAGAAAACCTTCCAAAAGAGGAAACAG
AGTTTTTATCAATCCATTCTCAGATGACCAATTTGGAAGACATTGATGTCAATCATAAAA
GCAAGTTATCTTCTCTGCAAGATCTTGAAAAAACTAAACTTGAAGAACAAGTTCAAGAAT
TAGAAAGCCTCATATCCTCTTTGCAGCAACAGTTGAAAGAAACTGAACAAAACTATGAGG
CAGAGATCCACTGTTTACAGAAGAGGCTTCAAGCTGTTAGTGAGTCCACGGTTCCGCCAA
GCTTACCTGTTGATTCGGTGGTAATTACAGAATCTGATGCACAGAGAACAATGTACCCTG
GAAGTTGTGTGAAAAAGAATATTGATGGTACAATAGAGTTTTCTGGTGAATTTGGAGTGA
AAGAGGAAACAAATATCGTTAAGTTGCTTGAAAAACAATACCAAGAACAATTAGAAGAAG
AAGTAGCTAAGGTTATTGTGTCAATGAGTATAGCATTTGCTCAACAAACTGAACTGTCTA
GAATATCTGGGGGAAAAGAAAATACTGCATCATCAAAGCAAGCACATGCTGTGTGTCAGC
AAGAACAACATTATTTTAATGAAATGAAATTATCACAGGATCAAATTGGTTTTCAGACTT
TTGAGACAGTGGATGTGAAATTTAAAGAAGAATTTAAACCACTTAGTAAAGAGTTAGGAG
AACATGGAAAGGAAATTTTATTATCAAATAGTGATCCCCATGATATACCAGAATCAAAGG
ACTGTGTGCTGACTATTTCAGAAGAAATGTTCTCCAAAGATAAAACATTTATAGTTAGAC
AGTCTATTCATGATGAGATTTCAGTGTCAAGCATGGATGCTTCTAGACAACTAATGTTGA
ATGAAGAACAGTTGGAAGATATGAGACAGGAACTTGTACGACAATACCAAGAACATCAAC
AGGCAACGGAATTGTTAAGGCAAGCACATATGCGGCAAATGGAGAGACAGCGAGAAGACC
AGGAACAGCTACAAGAAGAGATTAAGAGACTTAATAGACAATTAGCCCAGAGATCCTCCA
TAGATAATGAAAACCTGGTTTCAGAGAGAGAGAGGGTGCTTTTAGAGGAGCTGGAAGCAC
TAAAGCAGCTGTCTTTAGCTGGAAGAGAGAAGCTGTGTTGTGAGCTGCGCAACAGCAGTA
CGCAAACACAGAATGGAAATGAAAACCAAGGAGAAGTTGAAGAACAAACATTTAAAGAAA
AGGAATTAGACAGAAAACCTGAAGATGTGCCTCCTGAGATTTTGTCTAATGAAAGCTTGC
ATGGAGGAATTTGGCCCCTAAGATTTTGGCTTCCCCATTGGATCATCAGTATGGAACGCA
GTCAGTATGGAACTCAAACAAGAAAGACAGTGTATGCACTCCAGAAAGCTAATAATAGAC
TTTTGAAGATCCTCTTAGAAGTTGTAAAGACAACAGCAGCTGTTGAAGAAACAATTGGTC
GCCATGTCCTTGGGATTCTAGATAGATCTAGTAAAAGCCAGTCATCTGCCAGCCTAATTT
GGAGGTCAGAAGCAGAGGCATCTGTAAAGTCATGTGTCCATGAGGAACATACAAGAGTTA
CAGATGAATCCATTCCCTCTTATTCTGGAAGTGATATGCCAAGAAATGACATTAACATGT
GGTCAAAAGTAACTGAGGAAGGAACAGAGCTGTCACAACGACTTGTGAGGAGTGGTTTTG
CTGGAACTGAAATAGACCCTGAAAATGAAGAACTTATGCTGAACATTAGCTCTCGACTAC
AAGCAGCAGTTGAAAAACTCCTAGAAGCCATAAGTGAAACTAGCAGTCAGCTTGAACATG
CGAAAGTGACACAGACAGAGTTGATGCGTGAGTCATTTAGACAGAAACAAGAAGCAACAG
AGTCCCTTAAGTGCCAAGAGGAACTTCGAGAGCGCCTTCATGAGGAGTCCAGGGCCAGAG
AACAGCTAGCTGTGGAGCTCAGTAAGGCTGAGGGCGTCATTGATGGCTATGCAGATGAAA
AAACTCTTTTTGAAAGGCAAATTCAGGAAAAAACTGATATAATAGATCGTCTTGAGCAGG
AGTTGTTATGTGCAAGTAACAGGTTGCAAGAATTGGAGGCAGAGCAACAGCAGATCCAAG
AAGAAAGAGAATTACTGTCCAGACAAAAGGAAGCTATGAAAGCAGAGGCAGGCCCAGTTG
AACAACGACTAGTAGATGCTGCAGTCGATGCAGCACCAGGAGCAGAATTACTACAGGAGA
CAGAAAAATTAATGAAGGAAAAACTAGAAGTACAATGTCAAGCTGAAAAAGTACGTGATG
ACCTTCAAAAACAAGTGAAAGCTCTAGAAATAGATGTGGAAGAACAAGTCAGTAGGTTTA
TAGAGCTGGAACAAGAAAAAAATACTGAACTAATGGATTTAAGACAGCAAAACCAAGCAT
TGGAAAAGCAGTTAGAAAAAATGAGAAAATTTTTAGATGAGCAAGCCATTGACAGAGAAC
ATGAGAGAGATGTATTCCAACAGGAAATACAGAAACTAGAACAGCAACTTAAGGTTGTTC
CTCGATTCCAGCCTATCAGTGAACATCAAACTAGAGAGGTTGAACAGTTAGCAAATCATC
TGAAAGAAAAAACAGACAAATGCAGTGAGCTTTTGCTCTCTAAAGAGCAGCTTCAAAGGG
ATATACAAGAAAGGAATGAAGAAATAGAGAAACTGGAGTTCAGAGTAAGAGAACTGGAGC
AGGCGCTTCTTGTAGAGGACCGAAAACACTTTGGAGCTGTAGAAGCTAAACCAGAATTGT
CCCTAGAAGTACAATTGCAGGCTGAACGAGATGCCATAGACAGAAAGGAAAAAGAGATTA
CAAACTTAGAAGAGCAATTAGAACAGTTTAGAGAAGAACTGGAAAATAAGAATGAAGAAG
TTCAACAATTACATATGCAATTAGAAATACAGAAAAAGGAATCTACTACCCGCCTACAAG
AACTTGAACAGGAAAACAAATTATTTAAGGATGACATGGAGAAACTGGGACTTGCCATAA
AGGAATCTGATGCCATGTCTACTCAAGACCAACATGTGCTATTTGGGAAATTTGCTCAAA
TAATACAGGAAAAAGAGGTAGAAATTGACCAATTAAATGAACAAGTTACGAAACTCCAGC
AGCAACTTAAAATTACAACAGATAACAAGGTTATTGAAGAAAAAAATGAACTGATAAGGG
ATCTTGAAACCCAAATAGAATGTTTGATGAGTGATCAAGAATGTGTGAAGAGAAATAGAG
AAGAAGAAATAGAGCAGCTCAATGAAGTGATTGAAAAACTTCAACAGGAATTGGCAAATA
TTGGACAGAAGACATCAATGAATGCTCATTCCCTCTCAGAAGAAGCAGACAGTTTAAAAC
ATCAATTGGATGTGGTTATAGCTGAAAAGCTGGCCTTGGAACAGCAAGTAGAAACCGCTA
ATGAAGAAATGACCTTCATGAAAAATGTACTTAAAGAAACCAATTTTAAAATGAATCAGC
TAACACAGGAATTATTCAGCTTAAAGAGAGAACGTGAAAGTGTGGAAAAGATTCAAAGCA
TACCAGAGAATAGTGTTAACGTGGCTATAGATCATCTGAGCAAAGACAAACCTGAACTAG
AAGTAGTCCTTACAGAGGATGCTCTTAAATCCCTAGAAAATCAGACATACTTCAAATCTT
TTGAAGAAAATGGCAAAGGTTCCATAATTAATTTGGAAACAAGGTTGCTACAACTTGAGA
GCACTGTTAGTGCAAAGGACTTAGAACTTACCCAGTGTTATAAACAAATAAAAGACATGC
AAGAACAAGGCCAGTTTGAAACAGAAATGCTTCAAAAGAAGATTGTAAACCTACAGAAAA
TAGTTGAAGAAAAAGTGGCTGCTGCTCTTGTCAGTCAAATCCAACTTGAGGCAGTTCAGG
AATATGCAAAATTCTGTCAAGATAATCAAACAATTTCATCAGAACCTGAAAGAACAAATA
TTCAGAATTTAAATCAACTAAGAGAAGATGAGTTGGGGTCAGATATATCAGCATTAACCT
TGAGAATATCAGAATTAGAAAGCCAGGTTGTTGAAATGCATACTAGTTTGATTTTAGAAA
AAGAACAAGTAGAAATTGCAGAAAAAAATGTTTTAGAAAAAGAAAAGAAGCTGCTAGAAC
TACAGAAGCTATTGGAGGGCAATGAGAAAAAACAGAGAGAGAAAGAAAAGAAAAGAAGCC
CTCAAGATGTTGAAGTTCTCAAGACAACTACTGAGCTATTTCATAGCAATGAAGAAAGTG
GATTTTTTAATGAACTCGAGGCTCTTAGAGCTGAATCAGTGGCTACCAAAGCAGAACTTG
CCAGTTATAAAGAAAAGGCTGAAAAACTTCAAGAAGAGCTTTTGGTAAAAGAAACAAATA
TGACATCTCTTCAGAAAGACTTAAGCCAAGTTAGGGATCACCTCGCAGAGGCAAAAGAGA
AATTGTCCATTTTAGAAAAAGAAGATGAGACTGAGGTACAAGAAAGCAAAAAGGCCTGCA
TGTTTGAGCCACTTCCTATAAAACTGAGTAAGAGCATTGCATCCCAGACAGATGGGACTC
TGAAGATCAGTAGCAGCAATCAGACTCCACAAATTCTTGTTAAAAATGCAGGAATACAAA
TTAATTTACAGAGTGAATGTTCCTCAGAAGAAGTTACTGAAATAATCAGTCAGTTTACTG
AAAAAATTGAGAAGATGCAAGAACTACATGCTGCTGAAATTTTGGACATGGAATCCAGAC
ATATTTCAGAAACTGAAACCTTAAAGAGGGAACACTATGTTGCCGTTCAGTTACTGAAAG
AGGAATGTGGTACCTTGAAGGCAGTGATACAGTGTCTGAGAAGTAAAGAGGGATCCTCAA
TTCCTGAGCTAGCACATTCTGATGCTTACCAGACTAGAGAAATATGCTCCAGTGATTCTG
GATCAGACTGGGGTCAGGGAATTTATCTTACACACAGTCAGGGATTTGACATAGCATCAG
AAGGCCGAGGAGAAGAAAGTGAAAGTGCAACAGATTCCTTTCCAAAGAAAATAAAGGGAT
TACTGAGAGCTGTCCATAATGAAGGCATGCAGGTGCTTTCTCTCACTGAGTCTCCCTATA
GTGATGGAGAGGACCATTCTATTCAGCAGGTTTCAGAACCTTGGCTAGAAGAGAGAAAAG
CTTACATCAATACAATCTCATCTCTAAAGGATTTAATTACAAAGATGCAACTGCAAAGAG
AAGCCGAGGTTTATGATAGTTCTCAATCTCATGAGAGCTTCTCAGACTGGCGAGGTGAAC
TACTGCTTGCCCTTCAACAAGTTTTCTTAGAAGAGCGTAGTGTTTTACTAGCAGCATTTC
GGACGGAGCTGACAGCTCTAGGTACTACAGATGCAGTTGGTTTACTAAACTGTTTGGAAC
AGAGAATACAAGAACAGGGTGTTGAATATCAAGCAGCTATGGAATGCCTCCAGAAAGCAG
ATAGAAGGAGTTTGTTATCTGAAATTCAGGCACTGCATGCACAAATGAATGGTAGGAAAA
TTACTCTGAAAAGAGAACAAGAGAGTGAGAAACCAAGCCAAGAACTCTTGGAATATAATA
TACAGCAGAAGCAGTCTCAAATGCTGGAGATGCAAGTGGAGCTCAGCAGTATGAAAGACA
GAGCAACGGAACTGCAGGAGCAGCTGAGTTCTGAGAAAATGGTGGTTGCTGAACTGAAGA
GTGAGCTTGCACAAACTAAATTGGAACTAGAAACAACACTCAAGGCACAGCATAAACACC
TAAAAGAATTGGAGGCTTTCAGGTTGGAAGTTAAAGATAAGACAGATGAAGTACATTTGC
TTAATGACACATTAGCAAGTGAACAGAAAAAATCAAGAGAGCTCCAGTGGGCTTTGGAGA
AAGAGAAAGCCAAGTTGGGACGCAGTGAAGAACGGGATAAAGAAGAACTTGAGGATCTGA
AGTTTTCACTTGAGAGTCAGAAACAAAGGAATCTTCAGCTAAATCTACTTTTGGAACAAC
AGAAACAACTACTGAACGAATCCCAGCAAAAAATAGAATCACAGAGAATGCTATATGATG
CCCAGTTGTCAGAAGAACAAGGTCGAAACTTAGAGCTTCAGGTACTTCTTGAATCTGAGA
AAGTTCGAATTCGGGAAATGAGTAGTACCCTAGATAGGGAGCGGGAATTGCACGCACAGC
TGCAGAGCAGTGATGGTACTGGACAGTCTCGGCCACCCTTGCCCTCAGAGGACCTACTGA
AAGAGCTGCAGAAACAGCTAGAGGAAAAACACAGTCGCATAGTAGAATTGTTAAATGAGA
CTGAAAAATATAAACTGGATTCTTTGCAAACACGACAGCAAATGGAAAAAGATAGGCAGG
TTCACAGGAAAACACTGCAGACAGAACAGGAGGCCAACACTGAGGGACAGAAAAAAATGC
ATGAGCTCCAGTCCAAAGTGGAAGATCTTCAGCGCCAGCTGGAAGAGAAAAGACAACAAG
TTTATAAGTTAGACCTTGAAGGACAGCGACTACAAGGAATCATGCAGGAATTCCAGAAGC
AAGAACTAGAACGAGAAGAAAAACGAGAAAGTAGAAGAATTCTGTATCAGAACCTTAATG
AGCCAACCACGTGGAGCTTAACCAGTGATAGAACTAGAAATTGGGTTCTTCAACAGAAAA
TAGAAGGAGAAACAAAAGAATCAAACTACGCTAAATTGATTGAAATGAATGGAGGAGGAA
CCGGCTGTAATCATGAATTAGAAATGATCAGACAAAAGCTTCAATGTGTAGCTTCAAAAC
TACAGGTTCTACCCCAGAAAGCCTCTGAGAGACTACAGTTTGAAACAGCAGATGATGAAG
ATTTCATTTGGGTTCAGGAAAATATTGATGAAATTATTTTACAACTACAGAAATTAACTG
GCCAGCAAGGTGAAGAGCCCAGCTTGGTGTCCCCAAGTACTTCTTGTGGCTCATTGACTG
AAAGACTACTGAGACAAAATGCTGAGCTGACAGGGCATATCAGTCAACTGACTGAAGAGA
AGAATGACTTAAGGAACATGGTTATGAAGCTGGAAGAGCAGATCAGGTGGTATCGACAGA
CAGGAGCTGGTAGAGATAATTCTTCCAGGTTTTCATTGAATGGTGGTGCCAACATTGAAG
CCATCATTGCCTCTGAAAAAGAAGTATGGAACAGAGAAAAATTGACTCTCCAGAAATCTT
TGAAAAGGGCAGAGGCTGAAGTATACAAACTGAAAGCTGAACTAAGAAATGACTCTTTAC
TTCAAACTCTGAGCCCTGATTCTGAACATGTCACTTTAAAGAGAATTTATGGTAAATACT
TGAGGGCAGAAAGTTTTCGAAAGGCTCTCATTTACCAGAAGAAATACCTGCTGCTGTTAC
TGGGTGGGTTCCAGGAATGTGAAGATGCCACCTTGGCCCTGCTTGCCCGGATGGGGGGGC
AGCCAGCTTTCACGGATCTAGAGGTGATCACCAATCGCCCAAAGGGCTTCACCAGGTTTC
GGTCGGCCGTCAGAGTATCCATTGCAATTTCCAGAATGAAATTTTTGGTTCGACGGTGGC
ATCGAGTCACAGGTTCTGTTTCCATCAATATTAACAGAGATGGCTTTGGACTGAATCAAG
GTGCAGAAAAGACTGACTCATTTTATCATTCTTCTGGTGGGCTGGAGTTATATGGAGAAC
CAAGACATACTACGTATCGCTCAAGATCAGATCTGGACTATATTAGGTCCCCTTTACCAT
TTCAGAATAGGTACCCAGGCACTCCAGCTGATTTCAATCCTGGTTCTTTAGCATGTTCTC
AGCTTCAGAATTACGATCCTGACAGAGCCCTAACAGATTATATCACTCGGCTAGAGGCAC
TGCAAAGACGACTTGGAACTATACAGTCAGGTGCTCTGAGTTTAACCACATCTTGGCAGC
ACCACAGTGCGAGACCCACAGCTCCCCTTTCTTTGAAATTCTTTCACACTCATTAGGATA
ATCAAAGCTTCCAGTTTAGTGCATGAGCTAATTATTAAGTTAGCCAAAGCTTAAACTCTT
GTAACCAGCAGAGAAACTGACTTTAAATAATTTAAGTGAAAATATGATTTATCACCCCAG
ATCCCACTCCTCCCAAAAATGATTTCCTACTATGTTCATTCAGCGGACTGATGACACAAA
ATGCACAATGAGCACCAGTGTGCAAGGTACTCTGAGTCTACAGAGCCTAACTGGAGAACG
TATTCCTAAGTAGCGCATGGCAGAAAGTGGTAAGGCCGTGCCGCAGCACTCCAGCCTGGG
CAGCAGAGCGAGACCCTGTCTCAAAGAAAAAAAAAAAAAAAAGAAAGTGGTAAGGCATGC
AAATCGGGTGGAGTTAAGGAGGAAGCACTTACTTTAAGCACTTAATGTAACCATTATCCC
TGCTACTATATTGTGCTTTTATGTATCATCGAAAAAAACTATCCCATTTAAAATACTTTG
TAAGGATTATTTTTTCTTTGTTCAAAAACAAAAAACAAGTCATACTTTAAAATAAAGGTG
GATTCCCTGTTCATGGAAGGAAAACCTCTTTTCCCTATCTCACTTCAGTTCACTCCTGAT
TCAGAGACTTTGAATCATTGAGTAGTTTATCTCTTCCTTCAAGAAATCATTTGTTTACAC
CCAAGCATCTTGTAGTAATAGGAAACTTTTATTATCATAGCTGAGTTTGTTGGTTTGCCT
AGGCTTGTTTTGTTTTGAGCATCCAAATTTCACAAGACCCAGATTTTGAAGACCAAAAGA
TTTTTCAAAAATGTATGAGGTATAGAACATCCAACTTTGAGAGCACTTTAAAAAAACTCT
AAATATTAGTCTCACCTACCTTGCCATAGAGCCAGTCATGGTGATTTTTACATATATATT
CAAAATCTCTTAAAAGTCAGCTTAAGTATATGGGCTGGGCGCGGTGGCTCATGC

Protein Sequence

>10142 : length: 3972
MEDEERQKKLEAGKAKIEELSLAFLVRQLAQFRQRKAQSDGQSPSKKQKKKRKTSSSKHD
VSAHHDLNIDQSQCNEMYINSSQRVESTVIPESTIMRTLHSGEITSHEQGFSVELESEIS
TTADDCSSEVNGCSFVMRTGKPTNLLREEEFGVDDSYSEQGAQDSPTHLEMMESELAGKQ
HEIEELNRELEEMRVTYGTEGLQQLQEFEAAIKQRDGIITQLTANLQQARREKDETMREF
LELTEQSQKLQIQFQQLQASETLRNSTHSSTAADLLQAKQQILTHQQQLEEQDHLLEDYQ
KKKEDFTMQISFLQEKIKVYEMEQDKKVENSNKEEIQEKETIIEELNTKIIEEEKKTLEL
KDKLTTADKLLGELQEQIVQKNQEIKNMKLELTNSKQKERQSSEEIKQLMGTVEELQKRN
HKDSQFETDIVQRMEQETQRKLEQLRAELDEMYGQQIVQMKQELIRQHMAQMEEMKTRHK
GEMENALRSYSNITVNEDQIKLMNVAINELNIKLQDTNSQKEKLKEELGLILEEKCALQR
QLEDLVEELSFSREQIQRARQTIAEQESKLNEAHKSLSTVEDLKAEIVSASESRKELELK
HEAEVTNYKIKLEMLEKEKNAVLDRMAESQEAELERLRTQLLFSHEEELSKLKEDLEIEH
RINIEKLKDNLGIHYKQQIDGLQNEMSQKIETMQFEKDNLITKQNQLILEISKLKDLQQS
LVNSKSEEMTLQINELQKEIEILRQEEKEKGTLEQEVQELQLKTELLEKQMKEKENDLQE
KFAQLEAENSILKDEKKTLEDMLKIHTPVSQEERLIFLDSIKSKSKDSVWEKEIEILIEE
NEDLKQQCIQLNEEIEKQRNTFSFAEKNFEVNYQELQEEYACLLKVKDDLEDSKNKQELE
YKSKLKALNEELHLQRINPTTVKMKSSVFDEDKTFVAETLEMGEVVEKDTTELMEKLEVT
KREKLELSQRLSDLSEQLKQKHGEISFLNEEVKSLKQEKEQVSLRCRELEIIINHNRAEN
VQSCDTQVSSLLDGVVTMTSRGAEGSVSKVNKSFGEESKIMVEDKVSFENMTVGEESKQE
QLILDHLPSVTKESSLRATQPSENDKLQKELNVLKSEQNDLRLQMEAQRICLSLVYSTHV
DQVREYMENEKDKALCSLKEELIFAQEEKIKELQKIHQLELQTMKTQETGDEGKPLHLLI
GKLQKAVSEECSYFLQTLCSVLGEYYTPALKCEVNAEDKENSGDYISENEDPELQDYRYE
VQDFQENMHTLLNKVTEEYNKLLVLQTRLSKIWGQQTDGMKLEFGEENLPKEETEFLSIH
SQMTNLEDIDVNHKSKLSSLQDLEKTKLEEQVQELESLISSLQQQLKETEQNYEAEIHCL
QKRLQAVSESTVPPSLPVDSVVITESDAQRTMYPGSCVKKNIDGTIEFSGEFGVKEETNI
VKLLEKQYQEQLEEEVAKVIVSMSIAFAQQTELSRISGGKENTASSKQAHAVCQQEQHYF
NEMKLSQDQIGFQTFETVDVKFKEEFKPLSKELGEHGKEILLSNSDPHDIPESKDCVLTI
SEEMFSKDKTFIVRQSIHDEISVSSMDASRQLMLNEEQLEDMRQELVRQYQEHQQATELL
RQAHMRQMERQREDQEQLQEEIKRLNRQLAQRSSIDNENLVSERERVLLEELEALKQLSL
AGREKLCCELRNSSTQTQNGNENQGEVEEQTFKEKELDRKPEDVPPEILSNESLHGGIWP
LRFWLPHWIISMERSQYGTQTRKTVYALQKANNRLLKILLEVVKTTAAVEETIGRHVLGI
LDRSSKSQSSASLIWRSEAEASVKSCVHEEHTRVTDESIPSYSGSDMPRNDINMWSKVTE
EGTELSQRLVRSGFAGTEIDPENEELMLNISSRLQAAVEKLLEAISETSSQLEHAKVTQT
ELMRESFRQKQEATESLKCQEELRERLHEESRAREQLAVELSKAEGVIDGYADEKTLFER
QIQEKTDIIDRLEQELLCASNRLQELEAEQQQIQEERELLSRQKEAMKAEAGPVEQRLVD
AAVDAAPGAELLQETEKLMKEKLEVQCQAEKVRDDLQKQVKALEIDVEEQVSRFIELEQE
KNTELMDLRQQNQALEKQLEKMRKFLDEQAIDREHERDVFQQEIQKLEQQLKVVPRFQPI
SEHQTREVEQLANHLKEKTDKCSELLLSKEQLQRDIQERNEEIEKLEFRVRELEQALLVE
DRKHFGAVEAKPELSLEVQLQAERDAIDRKEKEITNLEEQLEQFREELENKNEEVQQLHM
QLEIQKKESTTRLQELEQENKLFKDDMEKLGLAIKESDAMSTQDQHVLFGKFAQIIQEKE
VEIDQLNEQVTKLQQQLKITTDNKVIEEKNELIRDLETQIECLMSDQECVKRNREEEIEQ
LNEVIEKLQQELANIGQKTSMNAHSLSEEADSLKHQLDVVIAEKLALEQQVETANEEMTF
MKNVLKETNFKMNQLTQELFSLKRERESVEKIQSIPENSVNVAIDHLSKDKPELEVVLTE
DALKSLENQTYFKSFEENGKGSIINLETRLLQLESTVSAKDLELTQCYKQIKDMQEQGQF
ETEMLQKKIVNLQKIVEEKVAAALVSQIQLEAVQEYAKFCQDNQTISSEPERTNIQNLNQ
LREDELGSDISALTLRISELESQVVEMHTSLILEKEQVEIAEKNVLEKEKKLLELQKLLE
GNEKKQREKEKKRSPQDVEVLKTTTELFHSNEESGFFNELEALRAESVATKAELASYKEK
AEKLQEELLVKETNMTSLQKDLSQVRDHLAEAKEKLSILEKEDETEVQESKKACMFEPLP
IKLSKSIASQTDGTLKISSSNQTPQILVKNAGIQINLQSECSSEEVTEIISQFTEKIEKM
QELHAAEILDMESRHISETETLKREHYVAVQLLKEECGTLKAVIQCLRSKEGSSIPELAH
SDAYQTREICSSDSGSDWGQGIYLTHSQGFDIASEGRGEESESATDSFPKKIKGLLRAVH
NEGMQVLSLTESPYSDGEDHSIQQVSEPWLEERKAYINTISSLKDLITKMQLQREAEVYD
SSQSHESFSDWRGELLLALQQVFLEERSVLLAAFRTELTALGTTDAVGLLNCLEQRIQEQ
GVEYQAAMECLQKADRRSLLSEIQALHAQMNGRKITLKREQESEKPSQELLEYNIQQKQS
QMLEMQVELSSMKDRATELQEQLSSEKMVVAELKSELAQTKLELETTLKAQHKHLKELEA
FRLEVKDKTDEVHLLNDTLASEQKKSRELQWALEKEKAKLGRSEERDKEELEDLKFSLES
QKQRNLQLNLLLEQQKQLLNESQQKIESQRMLYDAQLSEEQGRNLELQVLLESEKVRIRE
MSSTLDRERELHAQLQSSDGTGQSRPPLPSEDLLKELQKQLEEKHSRIVELLNETEKYKL
DSLQTRQQMEKDRQVHRKTLQTEQEANTEGQKKMHELQSKVEDLQRQLEEKRQQVYKLDL
EGQRLQGIMQEFQKQELEREEKRESRRILYQNLNEPTTWSLTSDRTRNWVLQQKIEGETK
ESNYAKLIEMNGGGTGCNHELEMIRQKLQCVASKLQVLPQKASERLQFETADDEDFIWVQ
ENIDEIILQLQKLTGQQGEEPSLVSPSTSCGSLTERLLRQNAELTGHISQLTEEKNDLRN
MVMKLEEQIRWYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWNREKLTLQKSLKRAEA
EVYKLKAELRNDSLLQTLSPDSEHVTLKRIYGKYLRAESFRKALIYQKKYLLLLLGGFQE
CEDATLALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAISRMKFLVRRWHRVTGS
VSININRDGFGLNQGAEKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYP
GTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGALSLTTSWQHHSARP
TAPLSLKFFHTH