ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10103

Name

TSPAN1

Synonym

NET1|TM4C|TM4SF;tetraspanin 1;TSPAN1;tetraspanin 1

Definition

tetraspan 1|tetraspanin-1

Position

1p34.1

Gene Type

protein-coding

External Links

Links to cell senescence gene database

10103

Links to epithelial mesenchymal transition gene database

10103

Links to ovarian cancer gene database

10103

Links to endometrial cancer gene database

10103

Links to iHOP

10103

Sequence Information

Nucleotide Sequence

>10103 : length: 1639
TCCCGGCCTCAGACACACACACCAGCAGCTACACCTACACGCTGACCATCACAGGCACAC
AGAGGCACATCCACCTCACATCCACCTCATACTTGTGTACTCTCAGGGTTCAGTCTTTCA
TCCTATCCCTCTCTGATCTGTGCCTCCCAATACCTTCCAAGATGTTTACAGAGACCCTTC
TCCCTGTGCAGTTAGGAGTGTAAGGCAAGAGAGCCCCTACTTCATGGGGCAGATCAAGAG
CTGAGACCAAAGATGGTCTATGTTGCTGACCTTGTCCTGTCCTCCTGCTGTCTTAAACTA
TGATCCCTGCTGCGGTCACTGAAGCCTTTCCCTGTGAGCAGTGGTGTGTGAGAGCCAGGC
GTCCCTCTGCCTGCCCACTCAGTGGCAACACCCGGGAGCTGTTTTGTCCTTTGTGGAGCC
TCAGCAGTTCCCTCTTTCAGAACTCACTGCCAAGAGCCCTGAACAGGAGCCACCATGCAG
TGCTTCAGCTTCATTAAGACCATGATGATCCTCTTCAATTTGCTCATCTTTCTGTGTGGT
GCAGCCCTGTTGGCAGTGGGCATCTGGGTGTCAATCGATGGGGCATCCTTTCTGAAGATC
TTCGGGCCACTGTCGTCCAGTGCCATGCAGTTTGTCAACGTGGGCTACTTCCTCATCGCA
GCCGGCGTTGTGGTCTTTGCTCTTGGTTTCCTGGGCTGCTATGGTGCTAAGACTGAGAGC
AAGTGTGCCCTCGTGACGTTCTTCTTCATCCTCCTCCTCATCTTCATTGCTGAGGTTGCA
GCTGCTGTGGTCGCCTTGGTGTACACCACAATGGCTGAGCACTTCCTGACGTTGCTGGTA
GTGCCTGCCATCAAGAAAGATTATGGTTCCCAGGAAGACTTCACTCAAGTGTGGAACACC
ACCATGAAAGGGCTCAAGTGCTGTGGCTTCACCAACTATACGGATTTTGAGGACTCACCC
TACTTCAAAGAGAACAGTGCCTTTCCCCCATTCTGTTGCAATGACAACGTCACCAACACA
GCCAATGAAACCTGCACCAAGCAAAAGGCTCACGACCAAAAAGTAGAGGGTTGCTTCAAT
CAGCTTTTGTATGACATCCGAACTAATGCAGTCACCGTGGGTGGTGTGGCAGCTGGAATT
GGGGGCCTCGAGCTGGCTGCCATGATTGTGTCCATGTATCTGTACTGCAATCTACAATAA
GTCCACTTCTGCCTCTGCCACTACTGCTGCCACATGGGAACTGTGAAGAGGCACCCTGGC
AAGCAGCAGTGATTGGGGGAGGGGACAGGATCTAACAATGTCACTTGGGCCAGAATGGAC
CTGCCCTTTCTGCTCCAGACTTGGGGCTAGATAGGGACCACTCCTTTTAGGCGATGCCTG
ACTTTCCTTCCATTGGTGGGTGGATGGGTGGGGGGCATTCCAGAGCCTCTAAGGTAGCCA
GTTCTGTTGCCCATTCCCCCAGTCTATTAAACCCTTGATATGCCCCCTAGGCCTAGTGGT
GATCCCAGTGCTCTACTGGGGGATGAGAGAAAGGCATTTTATAGCCTGGGCATAAGTGAA
ATCAGCAGAGCCTCTGGGTGGATGTGTAGAAGGCACTTCAAAATGCATAAACCTGTTACA
ATGTTGCCAAAAAAAAAAA

Protein Sequence

>10103 : length: 258
MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFL
IAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTL
LVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVT
NTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLEFFSNSARRPPLPES
LYSTPIRRDHVFLQPSPP