ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

100272147

Name

CMC4

Synonym

C6.1B|MTCP1|MTCP1B|MTCP1NB|p8|p8MTCP1;C-x(9)-C motif containing 4;CMC4;C-x(9)-C motif containing 4

Definition

C-x(9)-C motif containing 4 homolog|MTCP-1 type A|cx9C motif-containing protein 4|mature T-cell proliferation 1|mature T-cell proliferation 1 neighbor protein|mature T-cell proliferation-1 type A|protein p8 MTCP-1

Position

Xq28

Gene Type

protein-coding

External Links

Links to cell senescence gene database

100272147

Links to epithelial mesenchymal transition gene database

100272147

Links to ovarian cancer gene database

100272147

Links to endometrial cancer gene database

100272147

Links to iHOP

100272147

Sequence Information

Nucleotide Sequence

>100272147 : length: 1042
CAGCACCTGGGAAACGCCCGCGCGGTTTGGGGCAGGCGTGGCCGTCGGGGCGGAGGGCGG
TGGCCGGCCGCGGTCCGGGCGTCAGGCCGGGCGGCGGGGGCGGCAGGGAGGCGGCGCTCT
GGGGCCGCAGGCGGACGTACTCTGTGAGCGGCGCCCGGGCGCCTGGGCAGGCGCCTCCCG
AGTACCGGCGCCCATTTTGCCCGCCCGCTAAGGAGACCCGTGCGCGGCCTACACGCTTGG
GGGACAGCCCTTTAAGACGACATCTCCGCGAACGCCGGCCTCTTGAGCCAGGGGGACGCT
CTTTTGAAAGTCAGTCCCAAAACAGTTAAGGTTTTATTTTATTTTGTTTTATTTCCAAGT
CACAGCCCCCGAATCTCGTACAACTCTCCCTGGACCACTTCCGGTTGCCGGCCCGCGCCT
CATAACTTCGGTTCGAGTGACCTCGGCCCGGGATGCCCCTCGGCTCACCCCGGGCTCACG
TCGCGATCCTGGCTTGAGTGGCCCAGGGTGGGAGACCTGGAAGTTTTAGCCTAGCTGTTC
TCAAGGCGGATTAATTAGCCCAAGAAACATTATATTCATTTTTCTGGATATGCCGCAGAA
GGATCCGTGCCAGAAGCAAGCCTGTGAGATACAGAAATGTTTACAAGCCAACAGCTACAT
GGAATCAAAGTGTCAGGCTGTCATCCAAGAACTGCGTAAGTGTTGTGCTCAGTATCCCAA
GGGAAGATCTGTCGTCTGTTCAGGATTTGAAAAAGAAGAGGAAGAAAACCTAACACGGAA
GTCTGCATCAAAGTAAAGTTCTTCTGAAGTGCTGCTCCATGTTTCCACCAAATGAATTTT
TTTTATCCTCCTGACTCTTCAGGCCAGGTAGCAGCAAATAGCAAATGAAAAAGTCAGCTA
CAAAAGTTAATGAATATGCCATCTATGCAGAACAGGCAGAAATATAAACACATTAAAAGA
CAAATATGTAGAATGTAATATACTGAGCTGCTAAAATAAACCTGTTTAAGAGAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

Protein Sequence

>100272147 : length: 68
MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEEN
LTRKSASK