ONGene
Top
Scroll To Top
Gene information | Literature | Expression | lncRNA | Mutation | Homolog

Basic Information

Gene ID

10023

Name

FRAT1

Synonym

frequently rearranged in advanced T-cell lymphomas 1;FRAT1;frequently rearranged in advanced T-cell lymphomas 1

Definition

FRAT-1|proto-oncogene FRAT1

Position

10q24.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Wnt signaling pathway;PANTHER;P00057

Disease

Serous cancer;FunDO

Disease

Esophageal tumor;FunDO

Disease

Ovarian cancer;FunDO

External Links

Links to cell senescence gene database

10023

Links to epithelial mesenchymal transition gene database

10023

Links to ovarian cancer gene database

10023

Links to endometrial cancer gene database

10023

Links to iHOP

10023

Sequence Information

Nucleotide Sequence

>10023 : length: 2651
GGATTCCGGCTCCCGCGGCTGCAGGCGCGCGGCTAGAGTGCCTGGCGGGCTCCGGCTTCC
GCGTCCGCCCCGGCCCCGGTCCAGACTTAGTCTTCAGCTCCGCGCCCGCTCCGCCGCGGC
CCACCGCGCCCGCCGGCAGCCGAGCCCCCAGCGACGCCCGCACAGCTCCGGGTGCCCAGA
CAGGGGGCCATGCCGTGCCGGAGGGAGGAGGAAGAGGAAGCCGGCGAGGAGGCGGAGGGG
GAGGAAGAGGAGGAGGACAGCTTCCTCCTACTGCAGCAGTCAGTGGCGCTGGGCAGCTCG
GGCGAGGTGGACCGGCTGGTGGCCCAGATCGGCGAGACGCTGCAGCTGGACGCGGCGCAG
CACAGCCCGGCCTCGCCGTGCGGGCCCCCGGGGGCGCCGCTGCGGGCCCCGGGGCCCCTG
GCTGCGGCGGTGCCGGCGGACAAGGCCAGGTCCCCGGCGGTGCCGCTGCTGCTGCCGCCC
GCGTTGGCGGAGACTGTGGGCCCGGCGCCCCCTGGGGTCCTGCGCTGCGCCCTGGGGGAC
CGCGGCCGCGTGCGGGGCCGCGCTGCGCCCTACTGCGTGGCCGAGCTCGCCACAGGCCCC
AGCGCGCTGTCCCCACTGCCCCCTCAGGCCGACCTTGATGGGCCTCCGGGAGCTGGCAAG
CAGGGCATCCCGCAGCCGCTGTCGGGTCCGTGCCGGCGAGGATGGCTCCGGGGCGCCGCC
GCCTCCCGCCGCCTGCAGCAGCGACGCGGGTCCCAACCAGAAACCCGCACAGGCGACGAC
GACCCGCACCGGCTTCTGCAGCAGCTAGTGCTCTCTGGAAACCTCATCAAGGAGGCCGTG
CGAAGGCTTCATTCGCGACGGCTGCAGTTACGTGCAAAGCTTCCCCAACGCCCGCTCCTG
GGACCTCTGTCGGCCCCGGTGCATGAACCCCCTTCGCCTCGCAGCCCTCGCGCGGCCTGC
AGTGACCCTGGCGCCTCCGGGAGGGCGCAGCTCAGAACTGGCGACGGCGTTCTTGTGCCT
GGCAGCTAACACGCCCGGGGTGGCCACAGCGCCAGCCTCAGACTGGAGGGCAAGGGGTTC
CCTTGAGGGCTGCAGTTCTACTCAGGCTGGTGGAGAACTCTGGCTTTTGGAAGCGAGAGT
AAAAAGCTAATGACGAGGAACCGAAAAATCGCGAGTGTTTCGCGGGTAACTGGGGTTGAG
GGCCAAAATATTTGGAATGAAGGACTTTGGCCCTATTTAAGGCAGATTTTACAGAGCGCA
CCTCAAACGTACAAGTCAGTAGGACTCCTTATTTGGCGTGACCCGACCTGGCCGCGGAGC
CTGCATTTCCTCGCAGCCTCTCAGTGCCCTCCAGCCCCGCGACCATGTGGCCACAATCCA
CGCTTCTCCGGATCGCGGTGCGCCGGAACCACGGAGGATGATGCCAGTTACTTGCTTTAC
CTTTTCAGGGCTGGCTCCTGATCCACTTTGGGGGAGGAGAACATGAGTAGATAATTTCAG
GGTGCAGCCCAATCTGCCAGACTTAAAAAAACCATCTTGTGTCTTTGGAGGTGCTGCTTA
ATACCAAACATGCGGTGCCATGAAGGGACCCTTTGGGGGTTGAATAGGAGTTAACCCCTG
CGCTCTCTTTGCAACTGTCTCTCTTCTCAGAGTGGTGGGGGAAGGCTGTACGACACGGGT
GGGGAAAGGAGGTGGGGGCGGGGAGTATTGAATGGTGGTGGAAGGGTAGAGAGGCGCGGA
GTGAACCCCACGCCCTGTCTAAAGTGTATTTTCAGAGCCGGCCCGCCTCTCCTCGGTTCA
AGGTCACTGTTTCCTGGGCACGCACTGGGTTGCGGGACAGAGTAGCCAGGTTCTGCCGGT
GCTCGGAGAAGAGCGCAGTGTTTTGCAAGTGCTGGAGTCTCCTGAGGACACGCGCGTCGC
CGCCACCGCGGGTGTGGGAAAGCGCGGACGTGCTGGGCGGCTGTGCTTCGGTAGGCGACC
ACCGCCCCTGGCCGCGCTCCGGGCTTTCACGGAAACTCCCGAGACCGGGCCCTGGGTTCC
TCCTCTCCTACTCGGCTCTGCAGTCCTACTCAAGCGGGTGGCTCTGGGATCCTGGGGGCC
TGGGTTGGGGGCTAGGGAGACGCCATGTGATGGACACTCCAGGGACACACAGCCTAGCAC
AGCAGCTTATAATGGGCTCTCCGGGGCCATTTGCAATAACAGCTGCAATTCCCTGGATAG
ACGAGTTGATTTCCTCCCTCTGCCCCTCCCCCAGCCATGCCAGCTGGCCTTTGTAAGTGC
AGGAAACCGAGTAGAAAATGTGACCCTCCAAATGGAGAAGCTGCAGGCTTTGCCATTGTG
AACCATGGTGAAGTGCTTGGAACATACTGTTCACTCACTCTAAAGGCGCTGAGACTGTGC
TGTTGTTCTCGTTTTTATAGTCAATGGCTTGTTCATCATCCAGATGTGGCTACTGACATA
TCTACACTTCGCACCGGAGTGTCTGGAATTGTGGCTATCCTGATTATAGGATTTTAACTT
AACTGAAATGCCTGCTTTGAATAAATGTGTTGGGTTTTTTGTTTGGTTTTATTTTATACT
TGCCATCAGTGAAAAAGATGTACAGAACACATTTCTCTGATCTCCATAAACATGAAAACA
CTTGAAATCTC

Protein Sequence

>10023 : length: 279
MPCRREEEEEAGEEAEGEEEEEDSFLLLQQSVALGSSGEVDRLVAQIGETLQLDAAQHSP
ASPCGPPGAPLRAPGPLAAAVPADKARSPAVPLLLPPALAETVGPAPPGVLRCALGDRGR
VRGRAAPYCVAELATGPSALSPLPPQADLDGPPGAGKQGIPQPLSGPCRRGWLRGAAASR
RLQQRRGSQPETRTGDDDPHRLLQQLVLSGNLIKEAVRRLHSRRLQLRAKLPQRPLLGPL
SAPVHEPPSPRSPRAACSDPGASGRAQLRTGDGVLVPGS